Property Summary

Ligand Count 372
NCBI Gene PubMed Count 87
PubMed Score 796.41
PubTator Score 116.62

Knowledge Summary

Patent (16,522)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 3.0

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma 1.322 4.0e-02
colon cancer -2.200 4.1e-08
glioblastoma -1.100 1.4e-03
group 3 medulloblastoma -1.200 2.5e-02
Multiple myeloma -1.026 5.8e-03
non diabetic and post-ischemic heart fai... 1.100 1.1e-03
non primary Sjogren syndrome sicca 1.100 2.7e-02
osteosarcoma 3.208 1.4e-10
ovarian cancer -1.400 7.1e-06
primitive neuroectodermal tumor -1.400 2.1e-03
psoriasis 2.400 2.2e-05
type II diabetes mellitus and post-ische... 1.200 5.7e-03

 IMPC Phenotype (1)

Gene RIF (68)

AA Sequence

MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVS      1 - 70
VLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIAL     71 - 140
MLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVL    141 - 210
AYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNI    211 - 280
VDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTT    281 - 350
INGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT                                    351 - 388
//

Text Mined References (90)

PMID Year Title