Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.83
PubTator Score 11.14

Knowledge Summary

Patent (368)

Gene RIF (11)

PMID Text
23928294 the HTR3E remained significant after correction for the number of variants investigated.
21192076 Data show that 5-HT3C, 5-HT3D, and 5-HT3E subunits are coexpressed with 5-HT3A in cell bodies of myenteric neurons, and that 5-HT3A and 5-HT3D were expressed in submucosal plexus of the human large intestine.
20602613 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20356718 This study provides additional evidence for a role of the serotonergic system and the 5-HT3 receptor in schizophrenia
20356718 Observational study of gene-disease association. (HuGE Navigator)
20021265 Observational study of gene-disease association. (HuGE Navigator)
19794330 Six functional and coding variants of the subunit genes HTR3A, HTR3B as well as the novel HTR3C, HTR3D, and HTR3E subunits in the response to haloperidol or risperidone, were assessed.
18614545 The binding site for miR-510 is solely located in the 3' UTR of the HTR3E gene. No predicted binding site for miR-510 exists in the 3' UTR of HTR3A.
18614545 MicroRNA-510 target site of the 3'UTR of HTR3A and HTR3E are associated with the irritable bowel syndrome with diarrhea.
18573276 Data show that 5-HT3 receptors locat in the nucleus tractus silitarius contribute to stress-induced suppression of the baroreflex.

AA Sequence

MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISF      1 - 70
AMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGL     71 - 140
TAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQ    141 - 210
THGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVP    211 - 280
FKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSL    281 - 350
LLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS    351 - 420
VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT                                      421 - 456
//

Text Mined References (19)

PMID Year Title
23928294 2014 5-HT3 receptor influences the washing phenotype and visual organization in obsessive-compulsive disorder supporting 5-HT3 receptor antagonists as novel treatment option.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21192076 2011 Serotonin receptor diversity in the human colon: Expression of serotonin type 3 receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E.
20602613 2010 Polymorphism in HTR3D shows different risks for acute chemotherapy-induced vomiting after anthracycline chemotherapy.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20522555 2010 RIC-3 exclusively enhances the surface expression of human homomeric 5-hydroxytryptamine type 3A (5-HT3A) receptors despite direct interactions with 5-HT3A, -C, -D, and -E subunits.
20356718 2010 A coding variant of the novel serotonin receptor subunit 5-HT3E influences sustained attention in schizophrenia patients.
20021265 2010 Two naturally occurring variants of the serotonin receptor gene HTR3C are associated with nausea in pregnancy.
19794330 2009 Influence of 5-HT3 receptor subunit genes HTR3A, HTR3B, HTR3C, HTR3D and HTR3E on treatment response to antipsychotics in schizophrenia.
19012743 2009 Characterisation of 5-HT3C, 5-HT3D and 5-HT3E receptor subunits: evolution, distribution and function.
18614545 2008 First evidence for an association of a functional variant in the microRNA-510 target site of the serotonin receptor-type 3E gene with diarrhea predominant irritable bowel syndrome.
18573276 2009 Central 5-HT receptors in cardiovascular control during stress.
17392525 2007 Characterization of the novel human serotonin receptor subunits 5-HT3C,5-HT3D, and 5-HT3E.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15157181 2004 The 5-hydroxytryptamine type 3 (5-HT3) receptor reveals a novel determinant of single-channel conductance.
14597179 2003 A cluster of novel serotonin receptor 3-like genes on human chromosome 3.
12801637 2003 Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.