Property Summary

Ligand Count 2
NCBI Gene PubMed Count 15
PubMed Score 3.23
PubTator Score 0.95

Knowledge Summary

Patent (395)

Gene RIF (10)

AA Sequence

MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYSVATHVNISFT      1 - 70
LSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLSDVFIEESVDQTPAGLMASMS     71 - 140
IVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVA    141 - 210
TNQYEQAIFHVAIRRRCRPSPYVVNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMND    211 - 280
LLPATSTSSHASLVAPLALMQTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLL    281 - 350
HCTGQGRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE    351 - 420
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT                                        421 - 454
//

Text Mined References (17)

PMID Year Title