Property Summary

NCBI Gene PubMed Count 67
PubMed Score 41.39
PubTator Score 63.25

Knowledge Summary

Patent (3,068)

Gene RIF (68)

PMID Text
26256989 The response to ondansetron for PONV was significantly influenced by the -100_-102AAG deletion polymorphisms of the 5-HT3B gene. Thus, the -100_-102AAG deletion variants may be a pharmacogenetic predictor for responsiveness to ondansetron for PONV.
25951416 Study demonstrates that the 5-HT3Br1 transcriptional variant of the 5-HT3B subunit can contribute to the functional properties of heteromeric receptors in a similar manner to the originally characterized 5-HT3B subunit
24880582 we found an association of the HTR3B with poor concentration in schizophrenia patients.These results suggest that the HTR3B may be involved in the attention problem of schizophrenia in Korean population.
24590108 variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to etiology of alcohol, cocaine, and nicotine dependence
24244382 This is the first study to show an association between 5-HTR3B and PCS scores, thus suggesting a role of the serotonin pathway in pain catastrophizing.
23972841 the stoichiometry of 5-HT3AB receptors on the plasma membrane
23897038 Polymorphisms in the HTR3B gene are predictors of reduced alcohol drinking in response to ondansetron.
23810831 The ability of 5-HT to gate the homomeric or heteromeric receptor appears to rely on the D loop triplet RQY of the complementary face.
23786674 HTR3B gene variants may contribute to variability in severity of and response to antiemetic therapy for nausea and vomiting of pregnancy.
23757001 Genetic variability within SLC6A4, HTR3A, and HTR3B contributes to the risk of alcohol dependence and related phenotypes.
23489111 Data suggest that HTR3A/HTR3B subunits readily form functionally distinct heteromeric receptors; molecular models have been developed regarding affinities of competitive ligands, non-competitive antagonists, and allosteric modulators. [REVIEW]
23464988 Five single nucleotide polymorphisms (SNPs) in HTR3A and HTR3B were found.
23290502 Genetic interactions between HTR3B, HTR3A and SLC6A4 play a significant role in nicotine dependence in both European American and African American smokers.
22832903 HTR3A and HTR3B were detected in all investigated brain tissues with the exception of the cerebellum, and large differences in the A:B subunit ratio were observed.
21840870 No associations were found with the 5-HT3B receptor haplotypes and the risk of delayed chemotherapy-induced nausea and vomiting in patients treated with ondansetron and metoclopramide.
21184810 findings indicate that HTR3A and HTR3B polymorphisms may not play a major role in the susceptibility to suicidal behavior in schizophrenia subjects.
20838391 The HTR3B rs1176744 gain-of-function Ser129 allele predicted alcohol dependence & was more common in men with alcohol and drug dependence.
20838391 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20602613 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20356718 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20168265 role of the subunits A and B of the HTR3 receptor using 140 schizophrenia patients taking clozapine for 6 months
20075642 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20021265 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19794330 Six functional and coding variants of the subunit genes HTR3A, HTR3B as well as the novel HTR3C, HTR3D, and HTR3E subunits in the response to haloperidol or risperidone, were assessed.
19741568 an involvement of serotonin receptor type 3B variants in the aetiopathology of eating disorders in humans.
19741568 Observational study of gene-disease association. (HuGE Navigator)
19713259 Genetic variations in the HTR3A and HTR3B gene seem to be associated with the individual risk of developing postoperative vomiting.
19328558 Observational study of gene-disease association. (HuGE Navigator)
19185213 5-HT3R might contribute to the imbalance between excitation and inhibition that characterize the brain of alcoholics
19185213 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19008750 5-HT3B(I143T)-containing 5-HT3AB receptors display significantly reduced cell surface expression and different signalling properties compared with WT 5-HT3AB receptors.
18982004 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18937842 Observational study of gene-disease association. (HuGE Navigator)
18807291 The results suggest that HTR3B is involved in the development of TRS in the Japanese population.
18807291 Observational study of gene-disease association. (HuGE Navigator)
18698232 Variants in the HTR3B gene is associated with psychiatric diseases
18518925 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18389280 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18300944 performed electrophoretic mobility shift and luciferase reporter gene assays to elucidate the effect of this -100_-102delAAG deletion polymorphism on the HTR3B promoter activity in PC-12 and HEK293 cells
18187416 the incorporation of the 5-HT3B subunit leads to spontaneous channel opening and altered ligand properties
18184810 an HTR3B variant associated with major depression dramatically augments the signaling of the human 5-HT3AB receptor
18079067 Observational study of gene-disease association. (HuGE Navigator)
17697394 The -100_-102AAG deletion variant of the 5-HT3B receptor gene may affect paroxetine-induced nausea.
17697394 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17010535 Different transcriptional regulation of the HTR3B gene by two alternative promoters in the peripheral and the central nervous system leads to expression of transcripts with variations in the 5' coding sequence.
16874005 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16534507 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16487942 Observational study of gene-disease association. (HuGE Navigator)
16314763 Six sequence variants found in Gilles de la Tourette syndrome.
15887114 5-HT excited human enteric neurons via 5-HT3 receptors, which may comprise both 5-HT3A and 5-HT3B receptor subunits.
15389765 Observational study of gene-disease association. (HuGE Navigator)
15293096 Observational study of gene-disease association. (HuGE Navigator)
15115912 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14557147 Observational study of gene-disease association. (HuGE Navigator)
12867984 By constructing chimaeric 5-HT3A and 5-HT3B subunits we identified a region (the 'HA-stretch') within the large cytoplasmic loop of the receptor that markedly influences channel conductance
12775740 Observational study of gene-disease association. (HuGE Navigator)
12775740 Only 1.3% of antiemetic treatment failure with 5-HT3 receptor antagonists is associated with 5-HT3B receptor gene variant
12750374 Cell surface expression of 5-hydroxytryptamine type 3 receptors is controlled by an endoplasmic reticulum retention signal
12363396 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILD      1 - 70
VDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSS     71 - 140
GTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELL    141 - 210
SVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVG    211 - 280
YTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADR    281 - 350
PRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY    351 - 420
LFMLGIYTITLCSLWALWGGV                                                     421 - 441
//

Text Mined References (71)

PMID Year Title
26256989 2015 Association of 5-HT3B Receptor Gene Polymorphisms with the Efficacy of Ondansetron for Postoperative Nausea and Vomiting.
25951416 2015 5-HT3 Receptor Brain-Type B-Subunits are Differentially Expressed in Heterologous Systems.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24880582 2014 Association between promoter polymorphism (rs10789970) in 5-hydroxytryptamine receptor 3B and poor concentration in schizophrenia.
24590108 2014 Association and interaction analyses of 5-HT3 receptor and serotonin transporter genes with alcohol, cocaine, and nicotine dependence using the SAGE data.
24244382 2013 Polymorphism in serotonin receptor 3B is associated with pain catastrophizing.
23972841 2013 The 5-HT3AB receptor shows an A3B2 stoichiometry at the plasma membrane.
23897038 2013 Determination of genotype combinations that can predict the outcome of the treatment of alcohol dependence using the 5-HT(3) antagonist ondansetron.
23810831 2013 Importance of recognition loops B and D in the activation of human 5-HT? receptors by 5-HT and meta-chlorophenylbiguanide.
23786674 2013 Pharmacogenetic predictors of nausea and vomiting of pregnancy severity and response to antiemetic therapy: a pilot study.
23757001 2013 Association, interaction, and replication analysis of genes encoding serotonin transporter and 5-HT3 receptor subunits A and B in alcohol dependence.
23489111 2013 Discriminating between 5-HT?A and 5-HT?AB receptors.
23464988 2013 Polymorphisms of the HTR3B gene are associated with post-surgery emesis in a Chinese Han population.
23290502 2013 Serotonin transporter and receptor genes significantly impact nicotine dependence through genetic interactions in both European American and African American smokers.
22832903 2012 Replication of functional serotonin receptor type 3A and B variants in bipolar affective disorder: a European multicenter study.
21840870 2011 Association of ABCB1, 5-HT3B receptor and CYP2D6 genetic polymorphisms with ondansetron and metoclopramide antiemetic response in Indonesian cancer patients treated with highly emetogenic chemotherapy.
21184810 2011 Are serotonin 3A and 3B receptor genes associated with suicidal behavior in schizophrenia subjects?
21179162 2010 A population-specific HTR2B stop codon predisposes to severe impulsivity.
21138434 2011 The identification of N-glycosylated residues of the human 5-HT3B receptor subunit: importance for cell membrane expression.
20838391 2011 Functional genetic variants that increase synaptic serotonin and 5-HT3 receptor sensitivity predict alcohol and drug dependence.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20602613 2010 Polymorphism in HTR3D shows different risks for acute chemotherapy-induced vomiting after anthracycline chemotherapy.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20356718 2010 A coding variant of the novel serotonin receptor subunit 5-HT3E influences sustained attention in schizophrenia patients.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20168265 2010 Influence of serotonin 3A and 3B receptor genes on clozapine treatment response in schizophrenia.
20075642 2010 Effects of the serotonin 1A, 2A, 2C, 3A, and 3B and serotonin transporter gene polymorphisms on the occurrence of paroxetine discontinuation syndrome.
20021265 2010 Two naturally occurring variants of the serotonin receptor gene HTR3C are associated with nausea in pregnancy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19794330 2009 Influence of 5-HT3 receptor subunit genes HTR3A, HTR3B, HTR3C, HTR3D and HTR3E on treatment response to antipsychotics in schizophrenia.
19741568 2009 Functional variants of the serotonin receptor type 3A and B gene are associated with eating disorders.
19713259 2009 Do variations in the 5-HT3A and 5-HT3B serotonin receptor genes (HTR3A and HTR3B) influence the occurrence of postoperative vomiting?
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19185213 2009 HTR3B is associated with alcoholism with antisocial behavior and alpha EEG power--an intermediate phenotype for alcoholism and co-morbid behaviors.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19008750 2008 Characterization of the effects of four HTR3B polymorphisms on human 5-HT3AB receptor expression and signalling.
18982004 2010 Review and meta-analysis of antidepressant pharmacogenetic findings in major depressive disorder.
18937842 2008 The influence of serotonin- and other genes on impulsive behavioral aggression and cognitive impulsivity in children with attention-deficit/hyperactivity disorder (ADHD): Findings from a family-based association test (FBAT) analysis.
18807291 2008 An association between serotonin receptor 3B gene (HTR3B) and treatment-resistant schizophrenia (TRS) in a Japanese population.
18698232 2008 Naturally occurring variants in the HTR3B gene significantly alter properties of human heteromeric 5-hydroxytryptamine-3A/B receptors.
18518925 2008 Genetic susceptibility to heroin addiction: a candidate gene association study.
18389280 2008 Polymorphisms in the novel serotonin receptor subunit gene HTR3C show different risks for acute chemotherapy-induced vomiting after anthracycline chemotherapy.
18300944 2008 Functional characterization of a -100_-102delAAG deletion-insertion polymorphism in the promoter region of the HTR3B gene.
18187416 2008 The 5-HT3B subunit confers spontaneous channel opening and altered ligand properties of the 5-HT3 receptor.
18184810 2008 High-frequency HTR3B variant associated with major depression dramatically augments the signaling of the human 5-HT3AB receptor.
18079067 2008 Genetic evaluation of the serotonergic system in chronic fatigue syndrome.
17697394 2008 Genetic polymorphisms in the 5-hydroxytryptamine type 3B receptor gene and paroxetine-induced nausea.
17392525 2007 Characterization of the novel human serotonin receptor subunits 5-HT3C,5-HT3D, and 5-HT3E.
17010535 2007 Tissue-specific alternative promoters of the serotonin receptor gene HTR3B in human brain and intestine.
16874005 2006 Effects of the serotonin type 2A, 3A and 3B receptor and the serotonin transporter genes on paroxetine and fluvoxamine efficacy and adverse drug reactions in depressed Japanese patients.
16571125 2006 Detection of human and rodent 5-HT3B receptor subunits by anti-peptide polyclonal antibodies.
16534507 The effect of 5-hydroxytryptamine 3A and 3B receptor genes on nausea induced by paroxetine.
16487942 2006 Distinguishable haplotype blocks in the HTR3A and HTR3B region in the Japanese reveal evidence of association of HTR3B with female major depression.
16314763 2005 Serotonin receptor genes HTR3A and HTR3B are not involved in Gilles de la Tourette syndrome.
15887114 2005 Serotonin excites neurons in the human submucous plexus via 5-HT3 receptors.
15389765 2004 Investigation of the human serotonin receptor gene HTR3B in bipolar affective and schizophrenic patients.
15293096 2004 Mutational analysis of serotonin receptor genes: HTR3A and HTR3B in fibromyalgia patients.
15115912 2004 Investigation of the association between 5-HT3A receptor gene polymorphisms and efficiency of antiemetic treatment with 5-HT3 receptor antagonists.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557147 2003 A polymorphism in the serotonin receptor 3A (HTR3A) gene and its association with harm avoidance in women.
12867984 2003 A cytoplasmic region determines single-channel conductance in 5-HT3 receptors.
12775740 2003 Variations in the 5-hydroxytryptamine type 3B receptor gene as predictors of the efficacy of antiemetic treatment in cancer patients.
12750374 2003 Cell surface expression of 5-hydroxytryptamine type 3 receptors is controlled by an endoplasmic reticulum retention signal.
12363396 2002 Novel mutations in 5-HT3A and 5-HT3B receptor genes not associated with clozapine response.
12359150 2002 Assembly and cell surface expression of homomeric and heteromeric 5-HT3 receptors: the role of oligomerization and chaperone proteins.
10521471 1999 The pharmacological and functional characteristics of the serotonin 5-HT(3A) receptor are specifically modified by a 5-HT(3B) receptor subunit.
9950429 1999 The 5-HT3B subunit is a major determinant of serotonin-receptor function.