Property Summary

NCBI Gene PubMed Count 249
PubMed Score 1179.60
PubTator Score 514.67

Knowledge Summary

Patent (31,887)


  Disease Sources (4)


  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytic glioma -2.700 0.001
ependymoma -2.800 0.004
oligodendroglioma -2.700 0.002
glioblastoma -3.000 0.000
medulloblastoma, large-cell -3.000 0.004
primitive neuroectodermal tumor -3.000 0.001
pediatric high grade glioma -2.500 0.000
sonic hedgehog group medulloblastoma -2.400 0.006
pilocytic astrocytoma -2.700 0.000
psoriasis 1.400 0.017


Accession P28335 B1AMW4 Q5VUF8 Q9NP28 5-HT-2C
Symbols HTR1C


PANTHER Protein Class (2)

  Ortholog (10)

  TechDev Info (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2

Gene RIF (254)

26682995 the occurrence of hyperprolactinemia, although asymptomatic, was higher in the presence of the C allele of the rs6318 SNP of the HTR2C gene.
26259820 RNA element is discovered, which coordinates site-specific RNA editing on HTR2C pre-mRNA by an in vitro editing assay and secondary structural analysis of mutant HTR2C RNA fragments.
26160208 SLC6A14 and 5-HTR2C polymorphisms are associated with food intake and nutritional status in children.
25966590 The association between HTR2C and Machiavellianism was retained if the anxiety level was taken into account. The results suggest a pleiotropic effect of HTR2Con anxiety and Machiavellianism.
25825490 treatment with chemically distinct 5-HT2C receptor antagonists resulted in a time-dependent change in the quaternary organization to one in which there was a preponderance of receptor monomers.
25770211 cross-talk mediated via physical association of melatonin MT2 and 5-HT2C receptors into functional heteromers
25732952 ADARB1 rs9983925 and rs4819035 and HTR2C rs6318 were associated with suicide attempt risk.
25727097 Study demonstrates that the GHS-R1a/5-HT2C receptor interaction translates into a biologically significant modulation of ghrelin's orexigenic effect
25609374 demonstrate the homodimeric structure of 5-HT2C receptors endogenously expressed in their native cellular environment, and identifies the homodimer as a functional signaling unit.
25596490 found the lack of an association between 5-HT2C Cys/Ser variants and the risk of bipolar I disorder in Kurds population.

AA Sequence

EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV                                    421 - 458

Text Mined References (252)

PMID Year Title
26682995 2015 Hyperprolactinemia in Children and Adolescents with Use of Risperidone: Clinical and Molecular Genetics Aspects.
26259820 2015 Identification of an RNA element for specific coordination of A-to-I RNA editing on HTR2C pre-mRNA.
26160208 2015 SLC6A14 and 5-HTR2C polymorphisms are associated with food intake and nutritional status in children.
25966590 2015 [Association between serotonin receptor 2C gene Cys23Ser polymorphism and social behavior in schizophrenia patients and healthy individuals].
25825490 2015 Regulation of oligomeric organization of the serotonin 5-hydroxytryptamine 2C (5-HT2C) receptor observed by spatial intensity distribution analysis.
25770211 2015 Convergence of melatonin and serotonin (5-HT) signaling at MT2/5-HT2C receptor heteromers.
25732952 2015 Joint effect of ADARB1 gene, HTR2C gene and stressful life events on suicide attempt risk in patients with major psychiatric disorders.
25727097 2015 Ghrelin's Orexigenic Effect Is Modulated via a Serotonin 2C Receptor Interaction.
25609374 2015 Native serotonin 5-HT2C receptors are expressed as homodimers on the apical surface of choroid plexus epithelial cells.
25596490 2015 The serotonin transporter (5-HTTLPR) but not serotonin receptor (5-HT2C Cys23Ser) variant is associated with bipolar I disorder in Kurdish population from Western Iran.