Property Summary

NCBI Gene PubMed Count 260
PubMed Score 1199.28
PubTator Score 514.67

Knowledge Summary

Patent (31,887)


  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0


  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.400 3.0e-03
astrocytic glioma -2.700 1.4e-03
Astrocytoma, Pilocytic -2.700 7.9e-06
ependymoma -2.800 3.7e-03
glioblastoma -2.400 6.8e-07
group 4 medulloblastoma 1.300 4.4e-02
malignant mesothelioma -1.700 8.3e-06
medulloblastoma, large-cell -3.000 4.4e-03
oligodendroglioma -2.700 2.2e-03
primitive neuroectodermal tumor -3.000 1.2e-03
psoriasis 1.400 1.7e-02

Gene RIF (264)

AA Sequence

EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV                                    421 - 458

Text Mined References (263)

PMID Year Title