Property Summary

Ligand Count 554
NCBI Gene PubMed Count 69
PubMed Score 486.27
PubTator Score 175.63

Knowledge Summary

Patent (8,933)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -3.234 1.3e-05
invasive ductal carcinoma -1.300 1.3e-02
malignant mesothelioma 1.600 1.1e-05
non diabetic and post-ischemic heart fai... 1.200 4.4e-02
osteosarcoma -3.617 1.1e-04
psoriasis -4.000 1.1e-05

 CSPA Cell Line (2)

Gene RIF (38)

AA Sequence

MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIG      1 - 70
GNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFST     71 - 140
ASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLT    141 - 210
KERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEK    211 - 280
VAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLC    281 - 350
DSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP    351 - 420
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV             421 - 481
//

Text Mined References (74)

PMID Year Title