Property Summary

Ligand Count 131
NCBI Gene PubMed Count 21
PubMed Score 244.11
PubTator Score 18.08

Knowledge Summary

Patent (28,763)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.400 1.8e-04

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDF      1 - 70
LVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHA     71 - 140
GIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKT    141 - 210
LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR    211 - 280
QKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIF    281 - 350
NEDFKKAFQKLVRCRC                                                          351 - 366
//

Text Mined References (24)

PMID Year Title