Property Summary

NCBI Gene PubMed Count 49
PubMed Score 350.78
PubTator Score 184.96

Knowledge Summary

Patent (8,267)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.600 1.2e-03
malignant mesothelioma 2.600 1.2e-07

 MGI Phenotype (1)

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (36)

AA Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVLTTILLTRKLH      1 - 70
TPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAI     71 - 140
TDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPS    141 - 210
VLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIK    211 - 280
LADSALERKRISAARERKATKILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSL    281 - 350
INPIIYTVFNEEFRQAFQKIVPFRKAS                                               351 - 377
//

Text Mined References (53)

PMID Year Title