Property Summary

NCBI Gene PubMed Count 38
PubMed Score 410.57
PubTator Score 21.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (19)

PMID Text
26775844 These findings provide further evidence that histatin 3 may be involved in the regulation of cell proliferation, particularly during G1/S transition, via the ubiquitin-proteasome system of p27(Kip1) and HSC70.
26544073 Histatin 5 Salivary Complexes
24974109 High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase.
24951439 Hst 5 may affect mitochondrial functions and cause oxidative stress; however, the ultimate cause of cell death is by volume dysregulation and ion imbalance triggered by osmotic stress. [Review]
22033918 analysis of histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins
21741339 Histatin-5 is a likely transport molecule for toxic Ni(II) in human saliva.Its binding constant to nickel is five time higher than that of albumin.
20487276 Hst 5 binding to beta-glucans on the cell wall of C. albicans is salt-sensitive. Uptake of Hst 5 shows dose-dependent translocation and intracellular accumulation precede vacuole expansion and propidium iodide uptake.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19753800 Gene polymorphism at codon 23 of the histatin 3 gene was not associated with periodontitis in the Japanese population. Rather it appeared to be associated with resistance to periodontitis.
19753800 Observational study of gene-disease association. (HuGE Navigator)
19321452 These findings suggest that histatin 3 may be involved in cell proliferation through the regulation of HSC70 and p27(Kip1) in oral cells.
18650243 histatin 1 (Hst1) and histatin 2 (Hst2) as major wound-closing factors in human saliva
18230684 key steps of its lethal mechanism against parasites
17999963 Two cationic lysine residues at positions 2 and 10 in the P-113 peptide of Histatin 5 are important for transport into the cytosol of Candida albicans and that binding and transport are independent functional events.
17176059 A 20-residue-derived histatin 5 peptide preserves anticandidal activity, binds DNA, and has nuclease activity in the presence of copper and zinc ions.
15272024 results suggest that the genesis of histatin 3-related peptides, being under the principal action of trypsin-like activities, is probably not a random process but rather follows a sequential fragmentation pathway; cleavage sites are identified
12761219 study provides evidence for a novel function for yeast Ssa1/2 heat-shock proteins as cell envelope binding receptors for histatin 5 that mediate fungicidal activity
12183519 caused a loss of cell viability concomitant with a decrease in cellular volume as determined both by a classical candidacidal assay with exogenous Hst 5 and by using a genetically engineered C. albicans strain expressing Hst 5 (salivary histatin 5)
11816973 Killing of Candida albicans requires cellular uptake and energy metabolism (Histatin 5)

AA Sequence

MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN                         1 - 51
//

Text Mined References (40)

PMID Year Title
26775844 2016 Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination.
26544073 2015 In Vitro Identification of Histatin 5 Salivary Complexes.
24974109 2014 The assessment of sIgA, histatin-5, and lactoperoxidase levels in saliva of adolescents with dental caries.
24951439 2014 How does it kill?: understanding the candidacidal mechanism of salivary histatin 5.
23499434 2013 Reversible redox regulation of specificity of Arg-gingipain B in Porphyromonas gingivalis.
22033918 2011 Histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins.
21741339 2011 Salivary histatin-5, a physiologically relevant ligand for Ni(II) ions.
20973643 2010 Salivary peptidomics.
20487276 2010 Salivary histatin 5 internalization by translocation, but not endocytosis, is required for fungicidal activity in Candida albicans.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19753800 2009 Polymorphism of salivary histatin gene and periodontal disease in the Japanese population.
19321452 2009 Cooperation of salivary protein histatin 3 with heat shock cognate protein 70 relative to the G1/S transition in human gingival fibroblasts.
18650243 2008 Histatins are the major wound-closure stimulating factors in human saliva as identified in a cell culture assay.
18230684 2008 Human antimicrobial peptide histatin 5 is a cell-penetrating peptide targeting mitochondrial ATP synthesis in Leishmania.
17999963 2008 The P-113 fragment of histatin 5 requires a specific peptide sequence for intracellular translocation in Candida albicans, which is independent of cell wall binding.
17503797 2007 Tyrosine polysulfation of human salivary histatin 1. A post-translational modification specific of the submandibular gland.
17176059 2006 Metal-binding and nuclease activity of an antimicrobial peptide analogue of the salivary histatin 5.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15272024 2004 A cascade of 24 histatins (histatin 3 fragments) in human saliva. Suggestions for a pre-secretory sequential cleavage pathway.
14966203 2004 Immunocytochemical localization of histatins in human salivary glands.
12761219 2003 Candida albicans Ssa1/2p is the cell envelope binding protein for human salivary histatin 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12183519 2002 Human salivary histatin 5 causes disordered volume regulation and cell cycle arrest in Candida albicans.
11816973 2001 Killing of Candida albicans by histatin 5: cellular uptake and energy requirement.
11226423 2001 Zinc and copper bind to unique sites of histatin 5.
11179305 2001 Salivary histatin 5 is an inhibitor of both host and bacterial enzymes implicated in periodontal disease.
10794615 1999 Interaction of tannin with human salivary histatins.
10728974 2000 Molecular mapping of statherin- and histatin-binding domains in human salivary mucin MG1 (MUC5B) by the yeast two-hybrid system.
8945538 1996 Candidacidal activity of recombinant human salivary histatin-5 and variants.
8336540 1993 Nucleotide sequence analysis of the human salivary protein genes HIS1 and HIS2, and evolution of the STATH/HIS gene family.
7951254 1994 Two coding change mutations in the HIS2(2) allele characterize the salivary histatin 3-2 protein variant.
3426601 1987 Human submandibular gland statherin and basic histidine-rich peptide are encoded by highly abundant mRNA's derived from a common ancestral sequence.
3286634 1988 Histatins, a novel family of histidine-rich proteins in human parotid secretion. Isolation, characterization, primary structure, and fungistatic effects on Candida albicans.
2773933 1989 Localization of the genes for histatins to human chromosome 4q13 and tissue distribution of the mRNAs.
2719677 1989 Histatins, a family of salivary histidine-rich proteins, are encoded by at least two loci (HIS1 and HIS2).
2372245 1990 Rapid purification and characterization of histatins (histidine-rich polypeptides) from human whole saliva.
2344289 1990 Molecular cloning of human submandibular histatins.
2303595 1990 Structural relationship between human salivary histatins.