Property Summary

NCBI Gene PubMed Count 55
PubMed Score 56.42
PubTator Score 53.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.272 8.3e-05
astrocytic glioma -2.400 6.7e-03
posterior fossa group A ependymoma -1.800 1.8e-09
oligodendroglioma -2.100 2.1e-02
group 4 medulloblastoma -2.400 8.5e-07
cystic fibrosis 1.347 2.8e-05
atypical teratoid / rhabdoid tumor -2.100 1.2e-04
medulloblastoma, large-cell -2.000 3.5e-04
primitive neuroectodermal tumor -1.100 3.1e-02
acute quadriplegic myopathy 1.347 2.8e-06
intraductal papillary-mucinous adenoma (... 2.400 8.3e-05
intraductal papillary-mucinous carcinoma... 2.200 9.4e-04
intraductal papillary-mucinous neoplasm ... 2.900 8.4e-04
colon cancer -1.600 4.4e-02
lung cancer -3.200 3.7e-06
adult high grade glioma -1.300 9.9e-03
invasive ductal carcinoma 1.200 1.2e-02
ovarian cancer 1.700 6.6e-03
Breast cancer 1.200 1.3e-04
pituitary cancer -2.100 3.4e-07
dermatomyositis 1.200 4.2e-03

Gene RIF (41)

PMID Text
26752068 combination of sorafenib and metformin inhibits proliferation and invasion in vitro, prolongs median survival, and reduces lung metastasis of HCC in vivo. This effect is closely associated with the upregulation of TIP30
26718891 The results of the present study indicated that TIP30 may suppress oncogenesis and glioma progression, thereby improving the prognosis of patients with glioma.
26362536 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics
25986235 Increased HMGB1 and cleaved caspase-3 stimulate the proliferation of tumor cells and are correlated with the poor prognosis in colorectal cancer
25688879 Meta-analysis suggests that the rs2230199 C/G, rs1047286 C/T, rs11569536 G/A and rs2250656 A/G SNPs in the CC3 gene may be associated with age-related macular degeneration risk.
25617528 the present study showed that loss of HTATIP2 expression was a frequent event in glioma and is associated with poor prognosis.
25544767 Data iindicate TIP30 was a marker in predicting the prognosis of esophageal squamous cell carcinoma (ESCC).
25135222 TIP30-induced downregulation of cyclin D1 transcription antagonizes EGFR signaling and suppresses tumorigenesis
25008315 The combination of HTATIP2 and MVD predicts the converse survival of HCC with or without sorafenib intervention.
24681951 The results suggest a novel and critical role of TIP30 involved in hepatocellular carcinoma progression and aggressiveness.
24096486 miR-10b promotes pancreatic cancer cell proliferation and invasion by suppressing TIP30.
24037692 Decreased TIP30 expression is associated with pancreatic cancer.
23800048 We demonstrated the potential role of HTATIP2/TIP30 in ovarian cancer for the first time, thereby enlightening future studies targeting HTATIP2/TIP30 in ovarian cancer treatment, diagnosis, and prevention.
23178973 TIP30 binds to the DNA-binding domain and the C-terminal domain of p53
22733137 TIP30 acts as a crucial regulator in suppressing cytoplasmic and nuclear EGFR signaling in the lung.TIP30 functions as a tumor suppressor to inhibit EGFR cytoplasmic and nuclear signaling and suppress adenocarcinogenesis in the lung.
22490293 The loss of CC3/TIP30 is related to occurrence and development in breast cancer, suggesting early onset of metastasis and recurrence.
21731680 The TIP30 complex facilitates biological membrane fusion through modification of phosphatidic acid on membranes.
21543106 overexpression of MCM2 or loss of expression of Tat-interacting protein 30 is closely related to carcinogenesis, progression, biological behavior, and prognosis of gallbladder adenocarcinoma.
21252234 TIP30 complex regulates EGFR endocytosis by facilitating the transport of V-ATPases from trans-Golgi network to early endosomes.
21150275 Data suggest that metabolic flexibility acquired by cells after silencing of CC3 could be directly relevant to the development of metastatic and aggressive human tumors that frequently have low or absent expression of CC3.
20374651 Excess of cellular CC3 has a significant negative effect on DNA repair after UV and oxidant exposure, while silencing of endogenous CC3 slightly delays repair of UV-induced damage.
19839715 we examine the pathophysiological nature of remyelination failure in chronic multiple sclerosis and discuss the role of TIP30 as a novel therapeutic target--review
19798571 These results demonstrate that promoter methylation is involved in the decreased expression of TIP30 tumor suppressor gene in human colorectal carcinoma.
19349353 Decreased TIP30 expression promotes tumor metastasis in lung cancer.
19104151 Data suggest that oligodendrocyte precursor cells are pathogenic in multiple sclerosis and their nucleocytoplasmic transport is impaired due to abnormally upregulated TIP30.
19010857 epigenetic silencing of Tip30 gene expression by CpG island DNA hypermethylation is associated with poor prognosis in patients with HCC
18972434 a novel function of TIP30, which can possibly be used as an independent prognostic factor and a potential therapeutic target for gastric cancer.
18537194 Novel pathway by which OPN and possibly other Ets-1 target genes involved in tumor metastasis are regulated by TIP30. Mechanism for metastasis promoted by TIP30 deficiency.
18528861 TIP30 plays a role in prostate cancer progression and that TIP30 overexpression may promote prostate cancer cell growth and metastasis.
18519672 results suggest that TIP30 is involved in cellular oxidative stress surveillance and induces apoptosis through stabilization of p53 mRNA in hepatocellular carcinoma cells
17997990 Translocation of Bax was essential for TIP30-induced apoptosis, whereas overexpression of the anti-apoptotic protein Bcl-xL delayed both second mitochondria-derived activator of caspases (Smac/DIABLO) release and onset of apoptosis.
17097132 Data supported the theory that the expression of TIP30/CC3 had a suppressive function on tumor metastasis, and the decrease in expression of TIP30/CC3 is related to metastasis and may represent a new prognosticator in breast carcinoma.
16799960 Overexpression of TIP30 might be a promising candidate as a treatment for HCC that would increase sensitivity to chemotherapeutic drugs.
16615932 Finally, two inhibitors of cyclin-dependent kinase 9 (a dominant negative CDK9 and flavopiridol) repressed activity from the MR and BMPR2 promoters
15633220 TIP30 predisposes hepatoblastoma cells to apoptosis through regulating expression levels of these genes.
15493507 These data indicate that shear-induced VWF binding to platelet GpIb-IX-V activates Pyk2, ERK1/2, p38, and cPLA2.
15073177 TIP30 interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates ERalpha-mediated c-myc transcription.
10892349 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics
10698937 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics
10395547 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics
9482853 HIV-1 Gag interacts with HTATIP2 as demonstrated by proximity dependent biotinylation proteomics

AA Sequence

MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV      1 - 70
DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN     71 - 140
FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAM    141 - 210
LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP                                          211 - 242
//

Text Mined References (61)

PMID Year Title
26752068 2016 Metformin inhibits the prometastatic effect of sorafenib in hepatocellular carcinoma by upregulating the expression of TIP30.
26718891 2016 Overexpression of TIP30 inhibits the growth and invasion of glioma cells.
25986235 2015 Increased HMGB1 and cleaved caspase-3 stimulate the proliferation of tumor cells and are correlated with the poor prognosis in colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25688879 2015 Nonsynonymous single nucleotide polymorphisms in the complement component 3 gene are associated with risk of age-related macular degeneration: a meta-analysis.
25617528 2015 Downregulation of HTATIP2 expression is associated with promoter methylation and poor prognosis in glioma.
25544767 2015 TGF-?1 induces epigenetic silence of TIP30 to promote tumor metastasis in esophageal carcinoma.
25135222 2014 TIP30 nuclear translocation negatively regulates EGF-dependent cyclin D1 transcription in human lung adenocarcinoma.
25008315 2014 The combination of HTATIP2 expression and microvessel density predicts converse survival of hepatocellular carcinoma with or without sorafenib.
24681951 2015 Decreased TIP30 promotes Snail-mediated epithelial-mesenchymal transition and tumor-initiating properties in hepatocellular carcinoma.
24237036 2014 Large-scale quantification of single amino-acid variations by a variation-associated database search strategy.
24096486 2014 microRNA-10b enhances pancreatic cancer cell invasion by suppressing TIP30 expression and promoting EGF and TGF-? actions.
24037692 2014 Decreased TIP30 expression predicts poor prognosis in pancreatic cancer patients.
23800048 2013 High serum HTATIP2/TIP30 level in serous ovarian cancer as prognostic or diagnostic marker.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23178973 2012 TIP30 directly binds p53 tumor suppressor protein in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22733137 2013 TIP30 loss enhances cytoplasmic and nuclear EGFR signaling and promotes lung adenocarcinogenesis in mice.
22490293 2012 [Clinical significance of CC3/TIP30 expression in breast carcinoma and its correlation with HER-2/neu].
21731680 2011 The TIP30 protein complex, arachidonic acid and coenzyme A are required for vesicle membrane fusion.
21543106 2011 Clinicopathologic significance of minichromosome maintenance protein 2 and Tat-interacting protein 30 expression in benign and malignant lesions of the gallbladder.
21269460 2011 Initial characterization of the human central proteome.
21252234 2011 A novel TIP30 protein complex regulates EGF receptor signaling and endocytic degradation.
21150275 2010 CC3/TIP30 regulates metabolic adaptation of tumor cells to glucose limitation.
20374651 2010 CC3/TIP30 affects DNA damage repair.
19946888 2010 Defining the membrane proteome of NK cells.
19839715 2009 Factors that retard remyelination in multiple sclerosis with a focus on TIP30: a novel therapeutic target.
19798571 2010 Expression of TIP30 tumor suppressor gene is down-regulated in human colorectal carcinoma.
19349353 2009 Decreased TIP30 expression promotes tumor metastasis in lung cancer.
19104151 2009 Abnormal expression of TIP30 and arrested nucleocytoplasmic transport within oligodendrocyte precursor cells in multiple sclerosis.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19010857 2008 Methylation of Tip30 promoter is associated with poor prognosis in human hepatocellular carcinoma.
18972434 2009 Reduction of TIP30 correlates with poor prognosis of gastric cancer patients and its restoration drastically inhibits tumor growth and metastasis.
18537194 2008 Thirty-kilodalton Tat-interacting protein suppresses tumor metastasis by inhibition of osteopontin transcription in human hepatocellular carcinoma.
18528861 2008 TIP30 is associated with progression and metastasis of prostate cancer.
18519672 2008 TIP30 induces apoptosis under oxidative stress through stabilization of p53 messenger RNA in human hepatocellular carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17997990 2008 Tip30-induced apoptosis requires translocation of Bax and involves mitochondrial release of cytochrome c and Smac/DIABLO in hepatocellular carcinoma cells.
17097132 2007 TIP30/CC3 expression in breast carcinoma: relation to metastasis, clinicopathologic parameters, and P53 expression.
16799960 2006 TIP30 inhibits growth of HCC cell lines and inhibits HCC xenografts in mice in combination with 5-FU.
16615932 2006 HIV-1 Tat interaction with cyclin T1 represses mannose receptor and the bone morphogenetic protein receptor-2 transcription.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15728189 2005 Crystal structure of CC3 (TIP30): implications for its role as a tumor suppressor.
15633220 2005 TIP30 regulates apoptosis-related genes in its apoptotic signal transduction pathway.
15493507 2004 Role of the Pyk2-MAP kinase-cPLA2 signaling pathway in shear-dependent platelet aggregation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15282309 2004 Inhibition of nuclear import by the proapoptotic protein CC3.
15124103 2004 The novel gene encoding a putative transmembrane protein is mutated in gnathodiaphyseal dysplasia (GDD).
15073177 2004 TIP30 interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates c-myc transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695192 2003 TIP30 deficiency increases susceptibility to tumorigenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313954 2001 Metastasis suppressor CC3 inhibits angiogenic properties of tumor cells in vitro.
10892349 2000 Three-dimensional model of human TIP30, a coactivator for HIV-1 Tat-activated transcription, and CC3, a protein associated with metastasis suppression.
10698937 2000 TIP30 has an intrinsic kinase activity required for up-regulation of a subset of apoptotic genes.
10611237 2000 Alternatively spliced products CC3 and TC3 have opposing effects on apoptosis.
10395547 1999 TIP30, a cofactor for HIV-1 Tat-activated transcription, is homologous to short-chain dehydrogenases/reductases.
9482853 1998 A cofactor, TIP30, specifically enhances HIV-1 Tat-activated transcription.
9174052 1997 A link between metastasis and resistance to apoptosis of variant small cell lung carcinoma.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.