Property Summary

NCBI Gene PubMed Count 267
PubMed Score 3756.05
PubTator Score 2042.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.200 2.4e-02
oligodendroglioma -1.200 1.2e-02
tuberculosis and treatment for 3 months -1.700 5.6e-03

Gene RIF (178)

PMID Text
26585937 Data indicate that on addition of the heat-shock proteins GroEL-GroES molecular chaperone system, the folding of the nascent chemokine receptor type 5 (CCR5) was significantly enhanced.
26477505 Heat shock protein 60 stimulates the migration of vascular smooth muscle cells via Toll-like receptor 4 and ERK MAPK activation
26442925 The data show that immunohistochemistry for CD1a and Hsp60 can be of help in differential diagnosis between Keratoacantomas and well-differentiated forms of squamous cell carcinomas.
26431161 Studies show that contrary to its role as a target for pathogenic autoimmune inflammatory processes, heat-shock protein 60 (HSP60) has been shown to activate immunoregulatory pathways that may lead to suppression of these diseases.
26335776 Biochemical and genetic data demonstrate that FUS interacts with a mitochondrial chaperonin, HSP60, and that FUS translocation to mitochondria is, at least in part, mediated by HSP60
26275591 Anti-citrullinated protein antibodies promote apoptosis of mature human osteoblasts via cell-surface binding to citrullinated heat shock protein 60.
26078803 exposure of human promyelocytic HL-60 cells to a nontoxic concentration (10 muM) of 4-hydroxy-2-nonenal (HNE) yielded a HSP60 modified with HNE.
26060090 Hsp60 was found to be increased in cancerous tissue in patients with large bowel cancer
25957474 an HLD4-associated (Asp-29-to-Gly) mutant of mitochondrial heat shock 60-kDa protein 1 (HSPD1) causes short-length morphologies and increases the numbers of mitochondria due to their aberrant fission and fusion cycles
25918392 structural analysis of mutated human Hsp60-human Hsp10 complex
25801186 Hsp60 is increased in both animals and patients with TLE in affected tissues, and in plasma in response to epileptic seizures, and point to it as biomarker of hippocampal stress potentially useful for diagnosis and patient management.
25687758 Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation.
25654359 no significant relationship between anti-hsp60 antibodies and serological markers of infection was observed, which may only indicate an indirect role of infection in the assessment of breaking the immunological tolerance against autologous HSPs
25506707 The present study indicated that HSPD1 interacted with IRF3 and it contributed to the induction of IFN-beta.
25395618 Modified forms of LDL activate human T cells through dendritic cells. HSP60 and 90 contribute to such T-cell activation.
25207654 HSP60 overexpression was associated with the disease progression and prognosis in gastric cancer, and its expression significantly correlated with the expression of MMP-9.
24838263 Increased levels of anti-heat-shock protein 60 (anti-Hsp60) indicate endothelial dysfunction, atherosclerosis and cardiovascular diseases in patients with mixed connective tissue disease
24830947 Hsp60 mitochondrial import signal is stable in solution
24749912 Low level of HSP60 may lead to lack of anti-inflammatory response due to less Treg activation, hence, could be a counterpart in the pathogenesis of ITP.
24738046 These seven proteins, especially HSP 60, may serve as potential biomarkers for the diagnosis of RHD.
24680363 Antibodies to human HSP60 were found in 19 (15.8%) of 120 patients with a history of recurrent miscarriages.
24672802 Data suggest that up-regulation of HSP60/HSPD1 binding/reactivity leads to increased cytokine synthesis/secretion and other proinflammatory responses in adipocytes, especially in mature visceral adipocytes.
24643797 Levels of circulating autoantibodies against Hsp60, Hsp70, and Hsp90 were elevated and positively correlated with both cutaneous disease activity in dermatitis herpetiformis.
24618330 The immunological response to Hsp60/65 is increased in early clinical stages of ovarian cancer and the level of anti-hsp60/65 antibodies may be then a helpful diagnostic marker.
24582286 Lysine biotinylation and methionine oxidation in the heat shock protein HSP60 synergize in the elimination of reactive oxygen species.
24347824 Increased circulating level of HSP60 and HSP70 might play a role in initiation and/or progression of atherosclerosis in CKD subjects through perturbation of CD4(+)CD28(null) cells.
24327239 In postmenopausal women, serum HSP60 and anti-HSP70 concentrations increased with accumulating features of the metabolic syndrome. Results suggest an immune activation associated with cardiovascular risk in postmenopausal women with metabolic syndrome.
24123003 HSP60 protein expression may inhibit lymph node metastasis in papillary thyroid carcinomas harboring the BRAF mutation.
24113772 In acute cellular rejection and cyclophilin toxicity, distal tubules showed increased immunopositivity for Hsp27, 60 and 70i. In chronic allograft nephropathy there was also induction of Hsp27, 60 and 70i in the distal tubules but this was less pronounced
24099319 Citrullination of HSP60 is associated with neoplasms.
24084737 In type 2 diabetes, there is hypothalamic insulin resistance and mitochondrial dysfunction due to downregulation of the mitochondrial chaperone HSP60. HSP60 reduction was due to a lack of proper leptin signaling.
24057177 Regions in the Hsp60 molecule show structural similarity with the thyroglobulin (TG) and thyroid peroxidase (TPO) molecules supporting the notion that autoantibodies against TG and TPO are likely to recognize Hsp60 on the plasma membrane of oncocytes.
24015183 Hyperacetylation of Hsp60 seems to be associated with anticancer activity of geldanamycin.
23874603 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
23823174 The pathogenic variant of rs72466451 may play a role in a subgroup of sudden infant death syndrome cases with impaired Hsp60-mediated stress response.
23807299 Hsp60 levels were significantly higher than those of Hsp70 in neuroepithelial tumors, while levels of both molecules were not significantly different from each other in meningeal neoplasms
23466130 The expression of HSP-65 increased in myasthenia gravis patients and most individuals produced antibodies to it.
23439083 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
23439083 High levels of additive and synergic antiretroviral activity are obtained by using antiretroviral compounds (T1249, 3TC, RAL, or IDV) in PM1 cells stably expressing anti-host shRNAs (IPO7, HSPD1, or ATG16) or anti-HIV shRNAs (Pol, RT, or Nef)
23429486 High HSP60 mRNA expression was associated with advanced serous ovarian cancer.
23424650 association between elevated levels of antibodies against human HSP60 and disease may reflect a general activation of the immune system and an increased expression of human HSP60 in the synovium of patients with SpA
23388486 Suggest role for anti-HSP 60/65 antibodies in atherogenesis in patients with type 2 diabetes and lower limb ischemia.
23364796 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
23357787 Inhibited the activation of NF-kappaB in HSP60-stimulated macrophages.
23276948 Hsp60 is a key factor for protein homeostasis and cell survival, and this chaperonin is involved in various ways in the onset and progression of aging-related diseases.[review]
23192457 These data provide evidence for a role of C. pneumoniae as a potent primary endothelial stressor for arterial endothelial cells leading to enrichment of hHSP60 on the cellular membrane and, as such, a potential initiator of atherosclerosis.
23125841 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
23028910 Elevated circulating levels of Hsp60 may contribute to the immune dysfunction and non-AIDS clinical events seen in HIV-infected patients.
22944692 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
22933632 HSP65-induced effects on allergen-induced airway hyperresponsiveness and inflammation are associated with modulation of dendritic cell function and CD4+ T helper cell type (Th)1 cytokine production.
22931585 Immune reactivity to human hsp60 contributes to immunopathology in primary Sjogren's syndrome.
22901435 HSP60-reactive T-cells initiate atherosclerosis by recognition of atherogenic HSP60 epitopes.
22882677 In cardiovascular patients, a greater burden of subgingival infection with increased levels of P. gingivalis and T. forsythia is associated with modestly higher anti-hHSP60 levels.
22848686 a multistage process for the translocation of Hsp60 from the inside to the outside of the cell
22847064 results indicate that LOX-1 is essential in microglia for promoting an inflammatory response in the presence of soluble neuronal-injury signals such as extracellular HSP60, thereby linking neuroinflammation and neurotoxicity
22753410 a novel interaction between APP and HSP60, which accounts for its translocation to the mitochondria.
22575645 both GroEL and its isolated apical domain form amyloid-like fibrils under physiological conditions, and that the fibrillation of the apical domain is accelerated under acidic conditions.
22492505 pan-DR-binding HSP60 peptides induced low peptide-specific proliferative responses and peptide-specific production of some, mainly intracellular, cytokines in type 1 diabetes patients, without major differences between patients at various time points
22319627 showed an increase in the expression of genes encoding for chemokines/cytokines regulating the adhesion process and mediators of vascular remodeling (ADAM17, MCP1, and Hsp60)
22315307 Hsp60 might be a factor underlying adipose tissue inflammation and obesity-associated metabolic disorders.
22258649 Hsp60 proteins from humans and two common pathogens, Chlamydia trachomatis and Chlamydia pneumoniae, share various sequence segments of potentially highly immunogenic epitopes with acetylcholine receptor alpha1 subunit (AChRalpha1).
22140545 This is the first report clearly pointing to participation of heat shock proteins, particularly Hsp60, in chronic obstructive pulmonary diseases pathogenesis.
21748374 The study reports the presence of elevated levels of HSP60 in both saliva and serum of type 2 diabetic patients compared to non-diabetic controls.
21717087 The folding of mitochondrial-targeted green fluorescent protein, a well-known substrate protein of HSP60, was consistently impaired in cells expressing HSP60 variant with a mutation (Asp423Ala) in the ATPase domain.
21671464 High prognosis is associated with recurrence in lung adenocarcinoma.
21642380 Loss of the tumor suppression function of Hsp60 or GANAB contribute to aggressive cancers.
21497776 Hsp60 and HO-1 play distinct roles in the pathogenesis of AMI and subsequent AMI-related pathology
21361146 HSP60 expression was increased in HepG2 cells during cooling and rewarming. Cellular response to hypothermia could be associated with the synergistic induction of Hsp expression.
20978188 Data show that show that the molecular chaperone heat shock protein 60 (Hsp60) directly associates with cyclophilin D (CypD).
20953657 Externalized Heat-shock protein 60 in apoptotic cells and senescent platelets influences events subsequent to apoptosis, such as the clearance of apoptotic cells by phagocytes.
20947377 The elevated titer of anti-Hsp60 autoantibody could be a risk factor for cerebral small-vessel disease.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20806039 The aim of this study is to examine the expression of HSP60, HSP72, and HSP90, and heat-shock cognate 70 (HCS70) at the mRNA and protein level in differentiating corneal cells from limbal stem cells following air exposure.
20708221 Hsp60 is overexpressed in poorly differentiated prostate cancers & is associated with prognostic clinical parameters, like Gleason score, initial serum PSA, lymphatic metastasis, hormone-refractory disease & reduced cancer-specific survival.
20694586 High gene expression of Hsp60 is associated with leukemia.
20686813 cHSP60- and cHSP10-induced caspase expression, proinflammatory cytokine production and apoptosis of primary cervical epithelial cells might play a role in the pathogenesis of infertility in women with persistent chlamydial infection.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20362058 Results obtained demonstrated that recombinant human heat shock protein 60 was secreted efficiently from cells when fused to the leader peptide of interleukin-2 and the secreted protein was modified by N-linked glycosylation.
20351780 cytosolic Hsp60 is likely to be a regulatory component of IKK complex and a mitochondrial factor that regulates cell survival via NF-kappaB pathway
20169074 Data suggest that Hsp60 release is the result of an active secretion mechanism.
20082317 the association of PKM2 and HSPD1, two differentially expressed proteins, with MDR were analyzed, and the results showed that they could contribute considerably to the cisplatin resistance in ovarian cancer cell
19913588 this study suggests that HSP gene family, particularly HSP60, is involved in alveolar macrophage functions in a context of allergic asthma
19875724 Report HSP60-induced apoptosis via toll-like receptors in myocardium.
19764566 HSP60, TLR4 and NF-kappaBp65 are overexpressed in the peripheral blood of patients with atopic dermatitis.
19706612 These results suggest that the D3G mutation leads to entropic destabilization of the mHsp60 oligomer, which severely impairs its chaperone function, thereby causing MitCHAP disease.
19635199 The mRNA and protein levels of HSP60, HSP70 and HSP90alpha, as well as their positive rates were significantly increased in colorectal cancer tissues compared with those in para-cancerous tissues.
19576649 An association between type 2 diabetes mellitus and HSP60, suggesting that HSP60 may play an important role in the type 2 diabetes mellitus pathology.
19568603 The results suggest that HSP60 may be involved in the development of cervical cancer and have profound biological and prognostic significance.
19565483 Pan-DR-binding Hsp60 self epitopes induce an interleukin-10-mediated immune response in rheumatoid arthritis.
19475432 A single hemodialysis session raised the median value of Hsp60
19423133 SPG4 cases & their hereditary spastic paraplegic relatives were genotyped for the modifying variant in HSPD1. A sporadic patient was homozygous for the potential modifying variation. This variation's effect was not supported by identification in 1 family.
19386281 This novel data demonstrates that human endomyocardial HSP60 is increased following an acute rejection episode.
19369584 Coexpression of HSP60 and nuclear beta-catenin predicts a worse prognosis of metastatic head and neck cancer patients.
19346294 Mitochondrial HSP70 (mtHSP70) was identified as an HSP60 receptor. Stress was required for endothelial cells to up-regulate mRNA and express mtHSP70 on their surface.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19306954 Up-regulation of TLR-2 by HSP60 may play a critical role in promoting bone loss in the estrogen-deficient state.
19264393 impairment of Hsp60 function through binding of HCV core protein contributes to HCV viral pathogenesis by ROS generation and amplification of the apoptotic effect of TNF-alpha.
19261350 siRNA silencing of Hsp60 in Dengue virus infected monocytes resulted in decrease of viral RNA copy number and increased IFN-alpha expression
19210880 Serum IgG anti-hHSP60, but not anti-Chlamydia pneumoniae, antibodies were significantly increased in giant cell arteritis patients
19207939 the aminoacid sequences of the human HSP60 was compared with the bacterial counterpart to better elucidate how CTHSP60 may simulate HSP60 from human origin during infection and may induce an autoimmune response.
19205928 There were no significant differences in serum anti-Hsp60, anti-Hsp65, and anti-Hsp70 antibody levels between the control and preeclamptic groups.
19132982 HSP27 and HSP60 are predictors of biochemical recurrence of prostate cancer after radical prostatectomy.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19109096 Although oxidative stress may induce early apoptosis in NCI-H292 cells, Hsp60 exerts an anti-apoptotic effect in these cells.
19106391 A strong positive relationship is identified between circulating levels of heat shock protein 60 and the risk of coronary heart disease.
19022255 These results indicate that c-MYC may promote transformation through the induction of HSP60 expression.
19008717 HSP60 is a potent activator of vascular endothelial cells and smooth muscle cells. It is possible that long-term stimulation of these cell populations by blood-borne HSP60 acts to drive blood vessel changes resulting in decreased arterial elasticity.
18987317 The GroEL-GroES chamber behaves as a passive "Anfinsen cage" whose primary role is to prevent multimolecular association during folding.
18815895 Data show that mtDNA variability is able to influence the cellular response to heat stress by modulating both the transcription of HSP60 and 75 and their intra-mitochondrial protein levels.
18790094 mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin
18692161 HSP60 exerted a protective role in digoxin-induced apoptosis through inhibition of caspase-3 activity in HUVEC.
18571143 Mitochondrial HSP60 chaperonopathy causes an autosomal-recessive neurodegenerative disorder linked to brain hypomyelination and leukodystrophy.
18458233 HSP60 is a rare cause of hereditary spastic paraparesis, but may act as a genetic modifier.
18400758 Co-expression of Hsp60-(p.V98I) and wild-type Hsp60 exerted a dominant negative effect only when the chaperonin genes were expressed at relatively low levels.
18399535 Hsp60 is a key player in the resistance mechanism against oxidative stress and aging
18372523 a strong association between in vitro resistance to platinum compounds and increased HSP60 mRNA expression
18322079 Intracellular chaperone heat-shock protein 60 (HSP60) induces extensive axonal loss and neuronal death in microglial cultures from wild-type (but not TLR4 loss-of-function mutant) mice.
18320357 The GCTC haplotype in the hsp60 gene is significantly associated with higher coronary heart disease risk in a Chinese population.
18320357 Observational study of gene-disease association. (HuGE Navigator)
18240224 human (self) Hsp60 is a disease-relevant autoantigen in juvenile dermatomyositis
18229457 The extended range of plasma Hsp60 concentrations in the general population is genuine and is likely to be related to genetic, biological, and psychosocial risk factors for coronary artery disease.
17925998 Observational study of gene-disease association. (HuGE Navigator)
17925998 Three single nucleotide polymorphisms (SNPs) were studied in 100 RA trio families. Genetic analyses were performed by comparing allelic frequencies, applying the transmission disequilibrium test, and assessing the genotype relative risk.
17915559 Hsp60 and Hsp72 activation and inflammatory markers were correlated with the extent of cardiac and microvascular dysfunction in patients with angiographycally normal coronary arteries.
17823127 Cytosolic accumulation of HSP60 during apoptosis with or without apparent mitochondrial release: evidence that its pro-apoptotic or pro-survival functions involve differential interactions with caspase 3.
17675567 Abnormal trafficking of HSP60 to the cell surface may be an early trigger for myocyte loss and the progression of heart failure.
17670764 HSP60 was present in the uterus and oviduct epithelial cells and was shown to bind to human spermatozoa. Hsp60 partially prevented the increase in p81 phosphotyrosine content induced by the phosphodiesterase inhibitor 3-isobutyl-1-methylxanthine.
17588138 Extracellular Hsp60 levels are significantly elevated in children with septic shock compared with both healthy controls and critically ill children without sepsis. Extracellular Hsp60 may play a role in the pathogenesis of sepsis in children.
17553457 HSP60 and HSP70 released upon tissue damage might play a role in the regulation of bacteria-induced inflammation
17420924 Observational study of gene-disease association. (HuGE Navigator)
17420924 found that the function of the p.Gln461Glu heat shock protein 60 was mildly compromised. The c.1381C > G mutation likely represents a novel low-penetrance HSP allele.
17420921 Observational study of gene-disease association. (HuGE Navigator)
17206383 Plasminogen bound to hsps 27, 60, and 70 and Angiostatin predominantly bound to hsp 27 and to hsp 70 in a concentration- and kringle-dependent manner.
17202307 A negative association between Hsp60 in plasma, and seropositivity for three microbial agents which are risk factors for cardiovascular disease, suggest a protective effect of circulating stress protein Hsp60.
17174952 dysregulated expression of DHX32 might lead to as of yet unknown changes in mitochondrial homeostasis manifested by cytoplasmic redistribution of the molecular chaperon Hsp60
17075864 Yersinia Hsp60-specific T cells of one patient cross-reacted directly with human Hsp60
17072495 Investigation of single-nucleotide variations in the Hsp60 gene and their disease-causing potential.
16978514 Observational study of genotype prevalence. (HuGE Navigator)
16887805 Mitochondrial heat shock protein 60 is able to neutralize the inhibition of electron transport complex IV by amyloid beta-protein.
16843693 HSP60 is a potent inducer of venous smooth muscle cell (VSMC) proliferation; HSP60 uses TLR2 as well as TLR4 to cause its mitogenic effect on VSMCs
16767222 Results suggest that heat shock protein 60, a self-molecule, can downregulate adaptive immune responses by upregulating regulatory t cells innately through Toll-like receptor 2 signaling.
16705742 With HSP60, results from cell-lines correlated with clinical results, indicating that this model can be used for dissection of mechanisms involved in transformation to androgen resistance and assignment of protein markers in prostate cancer.
16320351 Hsp60 is an important target for anti-endothelial antibodies; such an interaction contributes to pathogenic effects, especially in vasculitis-associated systemic autoimmune disease
16254226 Our study provides the first prospective data confirming an association between high levels of sHSP60 and early carotid atherosclerosis.
16253146 HSP60 and HSP10 are expressed in large bowel carcinomas with lymph node metastases
16215457 The 14-3-3 protein forms molecular complex with Hsp60 and PrPC in human CNS under physiological conditions, and this complex might become disintegrated in pathologic process of prion diseases.
16148103 human HSP60 induced naive mouse B cells to proliferate and to secrete IL-10 and IL-6 and up-regulate their expression of MHC class II and accessory molecules
16116071 Autoantibodies recognizing amino acid residues 288 to 366 of HSP60 induce atherosclerosis via the mechanisms of autoimmune reactions to HSP60 expressed on arterial endothelial cells, which can be prevented by F(ab)2 segments derived from these antibodies
16075307 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
15957980 Mortalin and HSP60 interact both in vivo and in vitro, and that the N-terminal region of mortalin is involved in these interactions.
15879154 Atherosclerotic plaques harbor in vivo-activated CD4+ T cells that recognize the human 60-kDa HSP and become target for both autoreactive T cells and cross-reactive T cells to Chlamydia pneumoniae 60-kDa HSP via a mechanism of molecular mimicry.
15875659 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
15784682 Overall, we found clear evidence for the occurrence of HSP60 on the surface of stressed HUVECs in a very similar patchy distribution pattern in living and fixed cells
15763499 a decrease of Hsp60 in the cytoplasmic fraction of dilated cardiomyopathy-affected left ventricles was observed; at the same time an increase in P450 2E1 expression in dilated hearts' cytoplasmic fractions was observed
15661886 A defined region of HSP60 (amino acids 354-365) is involved in lipopolysaccharide (LPS) binding, thereby implicating a physiological role of human HSP60 as an LPS-binding protein.
15590416 The HSP60 is a mitochondrial chaperonin, highly preserved during evolution, responsible of protein folding. Its function is strictly dependent on HSP10 in both prokaryotic and eukaryotic elements.
15546885 Hsp10 exerts anti-inflammatory activity by inhibiting Toll-like receptor signaling possibly by interacting with extracellular Hsp60
15529360 T cell immunity to Hsp70 and Hsp90, like Hsp60-specific immunity, can modulate arthritogenic response in adjuvant arthritis. Regulatory mechanisms induced by Hsp60, Hsp70, and Hsp90 are reinforced by an immune network that connects their reactivities.
15251360 The perioperative kinetics of HSP60 in serum may result from suppressed protein synthesis caused by a reduced energy charge of hepatocytes during early reperfusion in liver transplantation.
15249499 A novel association between anti-heat shock protein 65 autoantibodies and occurrence of postoperative atrial fibrillation.
14634555 Chlamydial heat shock protein 60-1 antibodies are associated with an increased cervical cancer risk suggests that persistent Chlamydia trachomatis infection may contribute to cervical neoplasia.
14500649 A regulatory HSP60 peptide specifically recognized by the T cells of DNA-vaccinated rats is successfully used as an effective vaccine to inhibit the development of adjuvant arthritis in rats.
12965262 Evidence of elevated anti-HSP60 reactivity in the serum of patients with tic disorder supports HSP60 as an autoantigen and implicates the involvement of autoimmunity in tic disorders.
12869561 the host factor, Hsp60, is essential for in vivo hepatitis B virus replication, and the mechanism of Hsp60 is probably through an activation of HBV pol by Hsp60
12686536 The recombinant protein does not induce the release of tumor necrosis factor alpha from murine macrophages
12594256 Maturation of murine bone marrow-derived dendritic cells is strongly induced by human HSP60 and paralleled by release of Th1-promoting cytokines.
12515899 Deficiency of chaperonin 60 in Down's syndrome. A quantitative analysis by Western blots showed a marked reduction of Cpn60 per equal amount of total protein in DS cells to an average of 35% of normal.
12483302 The genome structure of this gene has been established.
12461076 HLA-E can present a peptide derived from the signal sequence of human hsp60.
12406306 HSP60 reactivity showed no apparent difference between normal and neoplastic odontogenic epithelium
12218165 A regulatory role for human HSP60 autoreactivity is demonstrated by DNA vaccine therapy of rat adjuvant arthritis that results in increased T cell proliferation and variable changes in cytokine production.
12215374 Gene expression of HSP1 was down-regulated during early apoptosis in human hepatoma cells exposed to Paeoniae Radix in vitro.
11932435 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
11898127 Hereditary spastic paraplegia SPG13 is associated with a mutation in the gene encoding the mitochondrial chaperonin Hsp60 (HSPD1)
11862386 promoter polymorphism of the IL-6 gene is associated with levels of antibodies to 60-kDa heat-shock proteins
11860186 H9724, a monoclonal antibody to Borrelia burgdorferi's flagellin, binds within live neuroblastoma cells, a potential role in peptide hormone signaling in an autoimmune pathogenesis of the neuropathy of Lyme disease.
11689615 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells
10499815 HIV-1 Tat upregulates the expression of heat shock 60kDa protein 1 (HSPD1; HSP60) in Jurkat cells

AA Sequence

MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGS      1 - 70
PKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEI     71 - 140
RRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDE    141 - 210
LEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDG    211 - 280
EALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIV    281 - 350
TKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR    351 - 420
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLI    421 - 490
VEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGA    491 - 560
MGGMGGGMGGGMF                                                             561 - 573
//

Text Mined References (283)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26585937 2015 Folding of newly translated membrane protein CCR5 is assisted by the chaperonin GroEL-GroES.
26477505 2015 Heat shock protein 60 stimulates the migration of vascular smooth muscle cells via Toll-like receptor 4 and ERK MAPK activation.
26442925 2016 CD1A-positive cells and HSP60 (HSPD1) levels in keratoacanthoma and squamous cell carcinoma.
26431161 2015 HSP60: a double edge sword in autoimmunity.
26335776 2015 FUS Interacts with HSP60 to Promote Mitochondrial Damage.
26275591 2016 Anti-citrullinated protein antibodies promote apoptosis of mature human Saos-2 osteoblasts via cell-surface binding to citrullinated heat shock protein 60.
26078803 2015 Generation of Adducts of 4-Hydroxy-2-nonenal with Heat Shock 60?kDa Protein 1 in Human Promyelocytic HL-60 and Monocytic THP-1 Cell Lines.
26060090 2015 Heat shock protein 60 levels in tissue and circulating exosomes in human large bowel cancer before and after ablative surgery.
25957474 2015 Hypomyelinating leukodystrophy-associated missense mutation in HSPD1 blunts mitochondrial dynamics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918392 2015 Crystal structure of the human mitochondrial chaperonin symmetrical football complex.
25801186 2015 Hsp60 response in experimental and human temporal lobe epilepsy.
25687758 2015 PRL-3 mediates the protein maturation of ULBP2 by regulating the tyrosine phosphorylation of HSP60.
25654359 2015 A relationship between serological markers of chronic C. pneumoniae and CMV infection and hsp60 in patients with atherosclerotic carotid stenosis.
25506707 2014 HSPD1 interacts with IRF3 to facilitate interferon-beta induction.
25416956 2014 A proteome-scale map of the human interactome network.
25395618 2015 Induction of dendritic cell-mediated T-cell activation by modified but not native low-density lipoprotein in humans and inhibition by annexin a5: involvement of heat shock proteins.
25207654 2014 Heat shock protein 60 overexpression is associated with the progression and prognosis in gastric cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24838263 2014 Increased levels of anti-heat-shock protein 60 (anti-Hsp60) indicate endothelial dysfunction, atherosclerosis and cardiovascular diseases in patients with mixed connective tissue disease.
24830947 2014 Human Hsp60 with its mitochondrial import signal occurs in solution as heptamers and tetradecamers remarkably stable over a wide range of concentrations.
24749912 2015 Decreased serum heat shock protein 60 levels in newly diagnosed immune thrombocytopenia patients.
24738046 2014 Comparison of the ventricle muscle proteome between patients with rheumatic heart disease and controls with mitral valve prolapse: HSP 60 may be a specific protein in RHD.
24680363 2014 Recurrent miscarriages, innate immunity, and autoimmune reaction to chlamydial 60-kDa heat shock protein--is there an association?
24672802 2014 Adipocytes from New Zealand obese mice exhibit aberrant proinflammatory reactivity to the stress signal heat shock protein 60.
24643797 2014 Evidence for a role of autoantibodies to heat shock protein 60, 70, and 90 in patients with dermatitis herpetiformis.
24618330 2014 Antibodies against Hsp60 and Hsp65 in the sera of women with ovarian cancer.
24582286 2014 Lysine biotinylation and methionine oxidation in the heat shock protein HSP60 synergize in the elimination of reactive oxygen species in human cell cultures.
24347824 2013 Heat shock proteins 60 and 70 specific proinflammatory and cytotoxic response of CD4+CD28null cells in chronic kidney disease.
24327239 2014 The 60- and 70-kDa heat-shock proteins and their correlation with cardiovascular risk factors in postmenopausal women with metabolic syndrome.
24286120 2014 GTP binding controls complex formation by the human ROCO protein MASL1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24123003 2013 Differential protein expression of lymph node metastases of papillary thyroid carcinoma harboring the BRAF mutation.
24113772 2013 Differential expression of heat shock proteins in healthy and diseased human renal allografts.
24099319 2013 Investigating citrullinated proteins in tumour cell lines.
24084737 2013 Leptin regulation of Hsp60 impacts hypothalamic insulin signaling.
24057177 2014 Elevated blood Hsp60, its structural similarities and cross-reactivity with thyroid molecules, and its presence on the plasma membrane of oncocytes point to the chaperonin as an immunopathogenic factor in Hashimoto's thyroiditis.
24015183 2013 Geldanamycin-induced osteosarcoma cell death is associated with hyperacetylation and loss of mitochondrial pool of heat shock protein 60 (hsp60).
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23840630 2013 Identification of Heat Shock Protein 60 as a Regulator of Neutral Sphingomyelinase 2 and Its Role in Dopamine Uptake.
23823174 2013 Functional single-nucleotide variant of HSPD1 in sudden infant death syndrome.
23807299 2013 Different immunohistochemical levels of Hsp60 and Hsp70 in a subset of brain tumors and putative role of Hsp60 in neuroepithelial tumorigenesis.
23466130 2013 Possible significance of anti-heat shock protein (HSP-65) antibodies in autoimmune myasthenia gravis.
23429486 2013 HSP60 predicts survival in advanced serous ovarian cancer.
23424650 2013 Increased levels of IgG antibodies against human HSP60 in patients with spondyloarthritis.
23388486 2012 Role of anti-HSP 60/65 antibodies in atherogenesis in patients with type 2 diabetes and lower limb ischemia.
23357787 2013 Characterization of human anti-heat shock protein 60 monoclonal autoantibody Fab fragments in atherosclerosis: genetic and functional analysis.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23276948 2013 Hsp60 and human aging: Les liaisons dangereuses.
23192457 2013 Chlamydia pneumoniae infection acts as an endothelial stressor with the potential to initiate the earliest heat shock protein 60-dependent inflammatory stage of atherosclerosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028910 2012 Circulating heat shock protein 60 levels are elevated in HIV patients and are reduced by anti-retroviral therapy.
22933632 2012 Microbial heat shock protein 65 attenuates airway hyperresponsiveness and inflammation by modulating the function of dendritic cells.
22931585 Increased immune reactivity towards human hsp60 in patients with primary Sjögren's syndrome is associated with increased cytokine levels and glandular inflammation.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22901435 2012 Autoreactive HSP60 epitope-specific T-cells in early human atherosclerotic lesions.
22882677 2012 Periodontal pathogen load and increased antibody response to heat shock protein 60 in patients with cardiovascular disease.
22848686 2012 The odyssey of Hsp60 from tumor cells to other destinations includes plasma membrane-associated stages and Golgi and exosomal protein-trafficking modalities.
22847064 2012 Microglial LOX-1 reacts with extracellular HSP60 to bridge neuroinflammation and neurotoxicity.
22753410 2012 Swedish Alzheimer mutation induces mitochondrial dysfunction mediated by HSP60 mislocalization of amyloid precursor protein (APP) and beta-amyloid.
22664726 2012 ATAD3B is a human embryonic stem cell specific mitochondrial protein, re-expressed in cancer cells, that functions as dominant negative for the ubiquitous ATAD3A.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22575645 2012 Fibrillogenic propensity of the GroEL apical domain: a Janus-faced minichaperone.
22492505 2012 Recognition of heat shock protein 60 epitopes in children with type 1 diabetes.
22319627 2012 Homocysteinylated albumin promotes increased monocyte-endothelial cell adhesion and up-regulation of MCP1, Hsp60 and ADAM17.
22315307 2012 Heat shock protein 60 as a mediator of adipose tissue inflammation and insulin resistance.
22258649 2012 The molecular anatomy of human Hsp60 and its similarity with that of bacterial orthologs and acetylcholine receptor reveal a potential pathogenetic role of anti-chaperonin immunity in myasthenia gravis.
22140545 2011 Convergent sets of data from in vivo and in vitro methods point to an active role of Hsp60 in chronic obstructive pulmonary disease pathogenesis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21753002 2011 Parkin interacts with Ambra1 to induce mitophagy.
21748374 2011 Detection of Hsp60 in saliva and serum from type 2 diabetic and non-diabetic control subjects.
21717087 2011 A cell model to study different degrees of Hsp60 deficiency in HEK293 cells.
21671464 2011 Heat shock protein-60 expression was significantly correlated with the prognosis of lung adenocarcinoma.
21642380 2011 Molecular chaperones as a common set of proteins that regulate the invasion phenotype of head and neck cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21497776 2011 Hsp60 and heme oxygenase-1 (Hsp32) in acute myocardial infarction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21361146 2010 Human hepatoma cell line (HepG2) cellular response to hypothermic stress with recovery. Induction of Hsp70, Hsp60 and Hsf1 expression.
21328542 2011 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer.
21276792 2011 Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
20978188 2010 Heat shock protein 60 regulation of the mitochondrial permeability transition pore in tumor cells.
20953657 2011 Heat-shock protein 60 translocates to the surface of apoptotic cells and differentiated megakaryocytes and stimulates phagocytosis.
20947377 2012 Elevated anti-heat shock protein 60 antibody titer is related to white matter hyperintensities.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20806039 2010 Assessment of heat shock protein (HSP60, HSP72, HSP90, and HSC70) expression in cultured limbal stem cells following air lifting.
20708221 2010 Immunohistochemical expression of Hsp60 correlates with tumor progression and hormone resistance in prostate cancer.
20694586 2011 Heat-shock protein expression in leukemia.
20686813 2011 Chlamydia trachomatis heat shock proteins 60 and 10 induce apoptosis in endocervical epithelial cells.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20362058 2010 Expression and purification of secreted recombinant hsp60 from eukaryotic cells.
20351780 2010 Cytosolic Hsp60 is involved in the NF-kappaB-dependent survival of cancer cells via IKK regulation.
20193073 2010 Chaperonin genes on the rise: new divergent classes and intense duplication in human and other vertebrate genomes.
20169074 2010 Hsp60 is actively secreted by human tumor cells.
20082317 2010 Quantitative proteome analysis of multidrug resistance in human ovarian cancer cell line.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913588 2010 Alveolar macrophages in allergic asthma: an expression signature characterized by heat shock protein pathways.
19875724 2009 Extracellular heat shock protein 60, cardiac myocytes, and apoptosis.
19764566 2009 [Expression of HSP60, TLR4 and NF-kappaBp65 in the peripheral blood of patients with atopic dermatitis].
19725078 2009 Proteomic analysis of increased Parkin expression and its interactants provides evidence for a role in modulation of mitochondrial function.
19706612 2009 The MitCHAP-60 disease is due to entropic destabilization of the human mitochondrial Hsp60 oligomer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19635199 2009 [Expressions of heat shock protein (HSP) family HSP 60, 70 and 90alpha in colorectal cancer tissues and their correlations to pathohistological characteristics].
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19576649 2009 Is heat shock protein 60 associated with type 2 diabetes mellitus?
19568603 2009 Expression of heat shock protein 60 kDa is upregulated in cervical cancer.
19565483 2009 Pan-DR-binding Hsp60 self epitopes induce an interleukin-10-mediated immune response in rheumatoid arthritis.
19475432 2009 Heat shock proteins in children and young adults on chronic hemodialysis.
19423133 2009 Sequence variants in SPAST, SPG3A and HSPD1 in hereditary spastic paraplegia.
19386281 2009 Myocardial heat shock protein 60 expression is upregulated following acute cardiac rejection.
19369584 2009 Interaction between HSP60 and beta-catenin promotes metastasis.
19346294 2009 Mitochondrial heat shock protein (HSP) 70 synergizes with HSP60 in transducing endothelial cell apoptosis induced by anti-HSP60 autoantibody.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19306954 2009 Increased circulating heat shock protein 60 induced by menopause, stimulates apoptosis of osteoblast-lineage cells via up-regulation of toll-like receptors.
19264393 2009 Interaction of hepatitis C virus core protein with Hsp60 triggers the production of reactive oxygen species and enhances TNF-alpha-mediated apoptosis.
19261350 2009 RNA interference mediated silencing of Hsp60 gene in human monocytic myeloma cell line U937 revealed decreased dengue virus multiplication.
19210880 Serum levels of antibodies to Chlamydia pneumoniae and human HSP60 in giant cell arteritis patients.
19207939 2009 A comparative analysis of the products of GROEL-1 gene from Chlamydia trachomatis serovar D and the HSP60 var1 transcript from Homo sapiens suggests a possible autoimmune response.
19205928 2009 Circulating anti-heat-shock-protein antibodies in normal pregnancy and preeclampsia.
19132982 2008 Heat shock proteins 27, 60 and 70 as prognostic markers of prostate cancer.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
19109096 Upon oxidative stress, the antiapoptotic Hsp60/procaspase-3 complex persists in mucoepidermoid carcinoma cells.
19106391 2008 Elevated heat shock protein 60 levels are associated with higher risk of coronary heart disease in Chinese.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19022255 2008 Direct regulation of HSP60 expression by c-MYC induces transformation.
19008717 2008 The relationship between carotid stiffness and circulating levels of heat shock protein 60 in middle-aged men and women.
18987317 2008 Chaperonin chamber accelerates protein folding through passive action of preventing aggregation.
18815895 2009 Mitochondrial DNA variability modulates mRNA and intra-mitochondrial protein levels of HSP60 and HSP75: experimental evidence from cybrid lines.
18790094 2008 cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins.
18692161 2008 Comparative proteomics analysis reveals role of heat shock protein 60 in digoxin-induced toxicity in human endothelial cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18571143 2008 Mitochondrial hsp60 chaperonopathy causes an autosomal-recessive neurodegenerative disorder linked to brain hypomyelination and leukodystrophy.
18458233 2008 HSP60 is a rare cause of hereditary spastic paraparesis, but may act as a genetic modifier.
18400758 2008 The Hsp60-(p.V98I) mutation associated with hereditary spastic paraplegia SPG13 compromises chaperonin function both in vitro and in vivo.
18399535 2008 Differential effect of oxidative stress on the apoptosis of early and late passage human diploid fibroblasts: implication of heat shock protein 60.
18372523 1997 Relationship between heat shock protein 60 (HSP60) mRNA expression and resistance to platinum analogues in human ovarian and bladder carcinoma cell lines.
18322079 2008 A vicious cycle involving release of heat shock protein 60 from injured cells and activation of toll-like receptor 4 mediates neurodegeneration in the CNS.
18320357 2008 Genetic variation in heat shock protein 60 gene and coronary heart disease in China: tagging-SNP haplotype analysis in a case-control study.
18319262 2008 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells.
18256040 2008 Hsp60-mediated T cell stimulation is independent of TLR4 and IL-12.
18240224 2008 Hsp60 in inflamed muscle tissue is the target of regulatory autoreactive T cells in patients with juvenile dermatomyositis.
18229457 2007 Plasma heat shock protein 60 and cardiovascular disease risk: the role of psychosocial, genetic, and biological factors.
18086682 2008 Hsp60 regulation of tumor cell apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17925998 2007 HSPD1 is not a major susceptibility gene for rheumatoid arthritis in the French Caucasian population.
17915559 2007 Circulating heat shock proteins and inflammatory markers in patients with idiopathic left ventricular dysfunction: their relationships with myocardial and microvascular impairment.
17823127 2007 Cytosolic accumulation of HSP60 during apoptosis with or without apparent mitochondrial release: evidence that its pro-apoptotic or pro-survival functions involve differential interactions with caspase-3.
17675567 2007 HSP60 in heart failure: abnormal distribution and role in cardiac myocyte apoptosis.
17670764 2007 Expression of Hsp60 and Grp78 in the human endometrium and oviduct, and their effect on sperm functions.
17588138 2007 Extracellular heat shock protein 60 (Hsp60) levels in children with septic shock.
17553457 2007 Diverse regulatory activity of human heat shock proteins 60 and 70 on endotoxin-induced inflammation.
17420924 2007 A novel mutation in the HSPD1 gene in a patient with hereditary spastic paraplegia.
17420921 2007 The role of hereditary spastic paraplegia related genes in multiple sclerosis. A study of disease susceptibility and clinical outcome.
17206383 2007 Plasminogen and angiostatin interact with heat shock proteins.
17202307 2007 Protective effect of human heat shock protein 60 suggested by its association with decreased seropositivity to pathogens.
17174952 2007 Altered distribution of heat shock protein 60 (Hsp60) with dysregulated expression of DHX32.
17164250 2007 Synergistic and differential modulation of immune responses by Hsp60 and lipopolysaccharide.
17075864 2006 Identification of immunodominant CD4+ T cell epitopes in patients with Yersinia-induced reactive arthritis by cytometric cytokine secretion assay.
17072495 2007 Single-nucleotide variations in the genes encoding the mitochondrial Hsp60/Hsp10 chaperone system and their disease-causing potential.
16978514 2006 [Polymorphisms of hsp 60 gene in Chinese Han people].
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16887805 2006 Differential effects of mitochondrial heat shock protein 60 and related molecular chaperones to prevent intracellular beta-amyloid-induced inhibition of complex IV and limit apoptosis.
16843693 2006 Human heat shock protein 60 stimulates vascular smooth muscle cell proliferation through Toll-like receptors 2 and 4.
16767222 2006 Heat shock protein 60 enhances CD4+ CD25+ regulatory T cell function via innate TLR2 signaling.
16705742 2006 Proteomic comparison of prostate cancer cell lines LNCaP-FGC and LNCaP-r reveals heatshock protein 60 as a marker for prostate malignancy.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16320351 2005 Induction of endothelial cell apoptosis by the binding of anti-endothelial cell antibodies to Hsp60 in vasculitis-associated systemic autoimmune diseases.
16254226 2005 Association of serum-soluble heat shock protein 60 with carotid atherosclerosis: clinical significance determined in a follow-up study.
16253146 2005 The expression of HSP60 and HSP10 in large bowel carcinomas with lymph node metastase.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16215457 2005 The 14-3-3 protein forms a molecular complex with heat shock protein Hsp60 and cellular prion protein.
16148103 2005 Heat shock protein 60 activates B cells via the TLR4-MyD88 pathway.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16116071 2005 Anti-heat shock protein 60 autoantibodies induce atherosclerosis in apolipoprotein E-deficient mice via endothelial damage.
15957980 2005 Identification and characterization of molecular interactions between mortalin/mtHsp70 and HSP60.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15879154 2005 Human 60-kDa heat shock protein is a target autoantigen of T cells derived from atherosclerotic plaques.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15784682 2005 Detection of HSP60 on the membrane surface of stressed human endothelial cells by atomic force and confocal microscopy.
15763499 2005 Molecular chaperone, HSP60, and cytochrome P450 2E1 co-expression in dilated cardiomyopathy.
15661886 2005 Heat shock protein 60: specific binding of lipopolysaccharide.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15590416 HSP10 selective preference for myeloid and megakaryocytic precursors in normal human bone marrow.
15546885 2005 Heat shock protein 10 inhibits lipopolysaccharide-induced inflammatory mediator production.
15529360 2004 Inhibition of adjuvant-induced arthritis by DNA vaccination with the 70-kd or the 90-kd human heat-shock protein: immune cross-regulation with the 60-kd heat-shock protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371451 2004 Lipopolysaccharide-free heat shock protein 60 activates T cells.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15251360 2004 Perioperative kinetics of heat shock protein 60 in serum during orthotopic liver transplantation.
15249499 2004 Association of anti-heat shock protein 65 antibodies with development of postoperative atrial fibrillation.
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15120623 2004 Interaction of the hepatitis B virus X protein (HBx) with heat shock protein 60 enhances HBx-mediated apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14500649 2003 DNA fragments of the human 60-kDa heat shock protein (HSP60) vaccinate against adjuvant arthritis: identification of a regulatory HSP60 peptide.
12965262 2003 Increased seroreactivity in tic disorder patients to a 60 kDa protein band from a neuronal cell line.
12942564 2003 Heat shock proteins HSP27, HSP60, HSP70, and HSP90: expression in bladder carcinoma.
12890148 2003 Expression levels of hsc70 and hsp60 are developmentally regulated during B-cell maturation and not associated to childhood c-ALL at presentation or relapse.
12869561 2003 Antisense oligodeoxynucleotides targeted against molecular chaperonin Hsp60 block human hepatitis B virus replication.
12813381 2003 Heat shock protein 60 expression in patients undergoing cardiac operations.
12768547 2003 Immunohistochemical study of heat shock proteins 27, 60 and 70 in the normal human adrenal and in adrenal tumors with suppressed ACTH production.
12686536 2003 Recombinant human heat shock protein 60 does not induce the release of tumor necrosis factor alpha from murine macrophages.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12611882 2003 Mitochondrially localized active caspase-9 and caspase-3 result mostly from translocation from the cytosol and partly from caspase-mediated activation in the organelle. Lack of evidence for Apaf-1-mediated procaspase-9 activation in the mitochondria.
12594256 2003 Human heat shock protein 60 induces maturation of dendritic cells versus a Th1-promoting phenotype.
12552239 2003 Hsp70 is present in human saliva.
12515899 2002 Deficiency of chaperonin 60 in Down's syndrome.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12483302 2003 Genomic structure of the human mitochondrial chaperonin genes: HSP60 and HSP10 are localised head to head on chromosome 2 separated by a bidirectional promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461076 2002 A signal peptide derived from hsp60 binds HLA-E and interferes with CD94/NKG2A recognition.
12406306 2002 Immunohistochemical analysis of inducible nitric oxide synthase (iNOS) and heat shock proteins (HSPs) in ameloblastomas.
12387818 2002 Chaperonin GroESL mediates the protein folding of human liver mitochondrial aldehyde dehydrogenase in Escherichia coli.
12218165 2002 Inhibition of adjuvant arthritis by a DNA vaccine encoding human heat shock protein 60.
12215374 2002 Paeoniae Radix, a Chinese herbal extract, inhibit hepatoma cells growth by inducing apoptosis in a p53 independent pathway.
12195124 2002 Circulating heat shock protein and heat shock protein antibody levels in established hypertension.
12105158 2002 Circulating human heat shock protein 60 in the plasma of British civil servants: relationship to physiological and psychosocial stress.
12070120 2002 Cytosolic heat shock protein 60, apoptosis, and myocardial injury.
11932435 2002 Specific incorporation of heat shock protein 70 family members into primate lentiviral virions.
11898127 2002 Hereditary spastic paraplegia SPG13 is associated with a mutation in the gene encoding the mitochondrial chaperonin Hsp60.
11888933 2002 Identification of heat shock protein 60 as a molecular mediator of alpha 3 beta 1 integrin activation.
11862386 2002 The promoter polymorphism of the IL-6 gene is associated with levels of antibodies to 60-kDa heat-shock proteins.
11807771 2002 Heat shock proteins 70 and 60 share common receptors which are expressed on human monocyte-derived but not epidermal dendritic cells.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11689615 2001 Functional interactions of human immunodeficiency virus type 1 integrase with human and yeast HSP60.
11591125 2001 Autoantibodies to pancreatic hsp60 precede the development of glucose intolerance in patients with cystic fibrosis.
11488911 2001 Thermodynamics of the folding of D-glyceraldehyde-3-phosphate dehydrogenase assisted by protein disulfide isomerase studied by microcalorimetry.
11445587 2001 A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11230124 2001 Recruitment, activation and retention of caspases-9 and -3 by Apaf-1 apoptosome and associated XIAP complexes.
11145923 2001 Changes in skeletal muscle heat shock proteins: pathological significance.
11144526 2000 Induction and membrane expression of heat shock proteins in heat-treated HPC-4 cells is correlated with increased resistance to LAK-mediated lysis.
11050098 2001 The importance of a mobile loop in regulating chaperonin/ co-chaperonin interaction: humans versus Escherichia coli.
10960671 2000 Stress proteins and the immune response.
10811634 2000 Protein substrate binding induces conformational changes in the chaperonin GroEL. A suggested mechanism for unfoldase activity.
10731000 2000 HSP expression in human leukocytes is modulated by endurance exercise.
10677329 2000 A new locus for autosomal dominant pure spastic paraplegia, on chromosome 2q24-q34.
10663613 2000 gammadelta T cells lyse autologous and allogenic oesophageal tumours: involvement of heat-shock proteins in the tumour cell lysis.
10632533 2000 Stress kinases and heat shock proteins in the pancreas: possible roles in normal function and disease.
10499815 1999 A 60 kD heat-shock protein-like molecule interacts with the HIV transmembrane glycoprotein gp41.
10467106 1999 Identification of human heat shock protein 60 (Hsp60) and anti-Hsp60 antibodies in the peripheral circulation of normal individuals.
10449265 1999 Heat shock proteins and heat shock protein-antibody complexes in placental tissues.
10382997 1999 Overexpression of the human 72 kDa heat shock protein in renal tubular cells confers resistance against oxidative injury and cisplatin toxicity.
10326659 1999 The expression of heat shock protein 60 in patients with dilated cardiomyopathy.
10231004 1999 Detection of the human 70-kD and 60-kD heat shock proteins in the vagina: relation to microbial flora, vaginal pH, and method of contraception.
10231001 1999 Heat shock proteins in human endometrium throughout the menstrual cycle.
10205159 1999 Hsp60 accelerates the maturation of pro-caspase-3 by upstream activator proteases during apoptosis.
10205158 1999 Presence of a pre-apoptotic complex of pro-caspase-3, Hsp60 and Hsp10 in the mitochondrial fraction of jurkat cells.
9890926 1999 EPR mapping of interactions between spin-labeled variants of human carbonic anhydrase II and GroEL: evidence for increased flexibility of the hydrophobic core by the interaction.
9724719 1998 Protein kinase A-catalyzed phosphorylation of heat shock protein 60 chaperone regulates its attachment to histone 2B in the T lymphocyte plasma membrane.
9243807 1997 Cell surface localization of the 60 kDa heat shock chaperonin protein (hsp60) in mammalian cells.
9150948 A two-dimensional gel database of human colon carcinoma proteins.
9150946 Two-dimensional electrophoretic analysis of human breast carcinoma proteins: mapping of proteins that bind to the SH3 domain of mixed lineage kinase MLK2.
9051195 1997 Macrophage-lysis mediated by autoantibodies to heat shock protein 65/60.
8979276 1996 Common antigenicity between Yersinia enterocolitica-derived heat-shock protein and the retina, and its role in uveitis.
8976559 1996 Significant hydrogen exchange protection in GroEL-bound DHFR is maintained during iterative rounds of substrate cycling.
8882520 1995 Presence of Chromatium vinosum chaperonins 10 and 60 in mitochondria and peroxisomes of rat hepatocytes.
8845058 1996 Expression of the human heat shock protein 60 in thyroid, pancreatic, hepatic and adrenal autoimmunity.
8689794 1996 [Immunostaining of mitochondrial heat shock proteins (mtHSPs) in skeletal muscle fibers of mitochondrial cytopathy].
8678928 1996 Induction of heat shock protein in monocytic cells by oxidized low density lipoprotein.
8676499 1996 Prion protein PrPc interacts with molecular chaperones of the Hsp60 family.
8671282 1996 Heat shock proteins in human endometrium throughout the menstrual cycle.
8559246 1996 Protein folding in the central cavity of the GroEL-GroES chaperonin complex.
7911805 1994 Molecular chaperones in pancreatic tissue: the presence of cpn10, cpn60 and hsp70 in distinct compartments along the secretory pathway of the acinar cells.
7907543 1994 Intestinal expression and cellular immune responses to human heat-shock protein 60 in Crohn's disease.
7895732 1994 The human myocardial two-dimensional gel protein database: update 1994.
7518175 1994 Immuno-gold electron microscopical detection of heat shock protein 60 (hsp60) in mitochondria of rat hepatocytes and myocardiocytes.
2907406 1988 Amino-acid sequence homology of a polymorphic cellular protein from human lymphocytes and the chaperonins from Escherichia coli (groEL) and chloroplasts (Rubisco-binding protein).
2568584 1989 Primary structure of a human mitochondrial protein homologous to the bacterial and plant chaperonins and to the 65-kilodalton mycobacterial antigen.
2079031 1990 Development of a database of amino acid sequences for human colon carcinoma proteins separated by two-dimensional polyacrylamide gel electrophoresis.
1980192 1990 Nucleotide sequences and novel structural features of human and Chinese hamster hsp60 (chaperonin) gene families.
1972619 1990 Mitochondrial import of the human chaperonin (HSP60) protein.
1731090 1992 Complex formation of human T-cell leukemia virus type I p40tax transactivator with cellular polypeptides.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1516759 1992 Immunocytochemical localization of heat-shock protein 60-related protein in beta-cell secretory granules and its altered distribution in non-obese diabetic mice.
1347942 1992 An interaction between p21ras and heat shock protein hsp60, a chaperonin.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.