Property Summary

NCBI Gene PubMed Count 34
PubMed Score 35.88
PubTator Score 28.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.2e-04
adult high grade glioma 2148 9.9e-04

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.000 1.2e-04
adult high grade glioma -1.100 9.9e-04

Gene RIF (19)

PMID Text
26538602 our results clearly show that HspBP1 acts as an endogenous negative regulator of HIV-1 gene-expression and replication by suppressing NF-kappaB-mediated activation of viral transcription.
24898092 Oxidative stress, inducing formation of disulfide bond, can affect stability and conformational mobility of human HspB1.
24454860 BAG-1M and HspBP1 had differential impacts on the dynamic composition of steroid receptor folding complexes
22037021 shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex
20694586 High gene expression of HspBP1 is associated with leukemia.
19659607 HspBP1 may play a role in tumor (dys)regulation of chaperone proteins
19183265 Our data suggest that HIP may prevent inclusion formation by facilitating the constitutive HSC70 refolding cycle and possibly by preventing aggregation.
18987994 Results indicate that low HspBP1 expression could be a marker of tumor aggressiveness.
18986301 The two chaperones, HSP72 and HSPBP1, interact both physically and functionally, leading to the activation of th EGFR-ERK1/2 signalling pathway.
18261988 Association between endogenous LAP2alpha and Hsp70 in non-transfected cells was confirmed by co-immunoprecipitation.
17855353 that HspBP1, by antagonizing the prosurvival activity of Hsp70, sensitizes tumor cells to cathepsin-mediated cell death.
17208201 Here, we report that upon the formation of huntingtin aggregates; endogenous cytosolic huntingtin, Hsc70/Hsp70 (heat shock protein and cognate protein of 70kDa) and syntaxin 1A become aggregate-centered.
16950797 Stress-induced heat shock protein 70 (Hsp70) effectively protects cells against ultraviol ray-induced apoptosis in melanocytes bu penetrating mitchondrial and lysosomal membranes.
16677834 The results demonstrate that Hsp70 and HspBP1 are not coordinately regulated but provide evidence that an increase in the ratio of HspBP1 to Hsp70 correlates with apoptosis, in a similar way to reducing the amount of Hsp70.
16169850 BAG2 binds to the carboxyl terminus of Hsp70-interacting protein (CHIP) and provides a cochaperone-dependent regulatory mechanism for preventing unregulated ubiquitylation of misfolded proteins by CHIP
15215316 HspBP1 interferes with the CHIP-induced degradation of immature forms of the cystic fibrosis transmembrane conductance regulator (CFTR) and stimulates CFTR maturation.
14761400 Detection of hsp70 may be used as the screening marker for diagnosis of polycyclic aromatic hydrocarbons (PAHs)-related lung cancer related lung cancer, and may supplement the diagnostic value of conventional cytology.
14503850 Results report cooperative interactions involving Hsp70, Hsp40, and TPR1 that enhance Hsp70-dependent folding of chemically denatured substrates.
9830037 The cochaperone HspBP1 binds to and inhibits Hsp70 activity.

AA Sequence

MSDEGSRGSRLPLALPPASQGCSSGGGGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPM      1 - 70
SEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNA     71 - 140
ADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVK    141 - 210
ALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL    211 - 280
VALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT    281 - 350
CFSSPADDSMDR                                                              351 - 362
//

Text Mined References (40)

PMID Year Title
26538602 2016 HSP70 binding protein 1 (HspBP1) suppresses HIV-1 replication by inhibiting NF-?B mediated activation of viral gene expression.
25416956 2014 A proteome-scale map of the human interactome network.
24898092 2014 Effect of disulfide crosslinking on thermal transitions and chaperone-like activity of human small heat shock protein HspB1.
24454860 2014 Hsp70 cochaperones HspBP1 and BAG-1M differentially regulate steroid hormone receptor function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22037021 2012 Extracellular HspBP1 inhibits formation of a cytotoxic Tag7-Hsp70 complex in vitro and in human serum.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20694586 2011 Heat-shock protein expression in leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19659607 2009 Heat shock protein 70-binding protein 1 is highly expressed in high-grade gliomas, interacts with multiple heat shock protein 70 family members, and specifically binds brain tumor cell surfaces.
19183265 2009 HSP70 interacting protein prevents the accumulation of inclusions in polyglutamine disease.
18987994 2009 HspBP1 levels are elevated in breast tumor tissue and inversely related to tumor aggressiveness.
18986301 2009 Extracellular HspBP1 and Hsp72 synergistically activate epidermal growth factor receptor.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18261988 2008 Lamina-associated polypeptide 2alpha forms complexes with heat shock proteins Hsp70 and Hsc70 in vivo.
17855353 2007 Anticancer drugs up-regulate HspBP1 and thereby antagonize the prosurvival function of Hsp70 in tumor cells.
17208201 2007 Aggregate-centered redistribution of proteins by mutant huntingtin.
16950797 2007 Hsp70 protects against UVB induced apoptosis by preventing release of cathepsins and cytochrome c in human melanocytes.
16831871 2006 CHIP protects from the neurotoxicity of expanded and wild-type ataxin-1 and promotes their ubiquitination and degradation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16677834 2006 Expression of the cochaperone HspBP1 is not coordinately regulated with Hsp70 expression.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169850 2005 Regulation of the cytoplasmic quality control protein degradation pathway by BAG2.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15694338 2005 Regulation of Hsp70 function by HspBP1: structural analysis reveals an alternate mechanism for Hsp70 nucleotide exchange.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15215316 2004 The cochaperone HspBP1 inhibits the CHIP ubiquitin ligase and stimulates the maturation of the cystic fibrosis transmembrane conductance regulator.
14761400 2003 [Co-detection of P21, P53 and HSP70 and their possible role in diagnosis of polycyclic aromatic hydrocarbons (PAHs)-related lung cancer].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14503850 2003 Cooperative interaction of Hsp40 and TPR1 with Hsp70 reverses Hsp70-HspBp1 complex formation.
12651857 2003 HspBP1, an Hsp70 cochaperone, has two structural domains and is capable of altering the conformation of the Hsp70 ATPase domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417338 2002 HspBP1, a homologue of the yeast Fes1 and Sls1 proteins, is an Hsc70 nucleotide exchange factor.
10786638 2000 Isolation and characterization of isoforms of HspBP1, inhibitors of Hsp70.
9830037 1998 Inhibition of Hsp70 ATPase activity and protein renaturation by a novel Hsp70-binding protein.
9727490 1998 Repression of heat shock transcription factor HSF1 activation by HSP90 (HSP90 complex) that forms a stress-sensitive complex with HSF1.