Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.46
PubTator Score 3.68

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BQS6 B3KSG6 Q52LB4 HspB9
Symbols CT51

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVV      1 - 70
QVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQ     71 - 140
TGPSPRLGSLGSKASNLTR                                                       141 - 159
//

Text Mined References (8)

PMID Year Title
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
15503857 2004 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820654 2003 The human genome encodes 10 alpha-crystallin-related small heat shock proteins: HspB1-10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470154 2001 Characterization of two novel human small heat shock proteins: protein kinase-related HspB8 and testis-specific HspB9.
5503857 1970 [Leiomyoma and leiomyosarcoma of the small intestine. Value of selective angiography].