Property Summary

NCBI Gene PubMed Count 86
PubMed Score 228.51
PubTator Score 95.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myopathy 128 3.112 1.6
Amyotrophic Lateral Sclerosis 432 3.086 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -1.100 1.9e-06
ependymoma 2.400 6.2e-03
oligodendroglioma 1.700 4.1e-02
esophageal adenocarcinoma -2.800 2.0e-02
psoriasis 2.500 2.9e-04
osteosarcoma 2.765 7.6e-03
sonic hedgehog group medulloblastoma -3.600 7.8e-09
cystic fibrosis -2.604 5.4e-06
glioblastoma -1.100 1.5e-02
atypical teratoid/rhabdoid tumor -3.000 5.7e-08
medulloblastoma, large-cell -2.900 1.5e-03
Atopic dermatitis -1.100 1.0e-03
adrenocortical carcinoma 1.967 2.3e-02
chronic kidney disease 1.300 1.7e-02
non-small cell lung cancer -1.900 8.1e-16
intraductal papillary-mucinous adenoma (... -2.000 1.2e-03
intraductal papillary-mucinous carcinoma... -1.500 2.9e-02
intraductal papillary-mucinous neoplasm ... -2.100 1.2e-02
lung cancer -2.500 3.1e-06
colon cancer -2.900 2.7e-10
lung adenocarcinoma -2.000 1.5e-17
non primary Sjogren syndrome sicca 1.100 3.1e-02
invasive ductal carcinoma -2.100 2.5e-02
nasopharyngeal carcinoma -2.200 1.2e-03
lung carcinoma -1.500 7.6e-10
spina bifida -2.098 3.7e-02
Breast cancer -1.600 5.3e-03
ductal carcinoma in situ -1.200 1.9e-02
ovarian cancer -2.400 9.0e-08

Pathway (1)

Gene RIF (52)

PMID Text
26718575 expands the understanding of disease mechanisms, tissue involvement, and phenotypic outcome of HSPB8 mutations
26694816 This study demonstreated that expression of HSPB8 was restricted to GFAP+ astrocytes in patient with multiple sclerosis.
26496431 our findings suggest the existence of a so-far unrecognized quality control mechanism involving BAG3, HSPB8 and p62/SQSTM1 for accurate remodelling of actin-based mitotic structures that guide spindle orientation.
25731856 HSP22 acts as a positive regulator in TGF-alpha-induced migration of ovarian cancer cells, subsequently directing ovarian cancer toward progression.
25051369 Pangenomic profiling of velcade-sensitive and resistant cells showed that the small heat shock protein HSPB8 was overexpressed in multiple myeloma resistant cells.
24804817 HSP22 plays an important role on gastric tumor aggressiveness and prognosis and may act as a promising target for prognostic prediction.
22898869 The expression of HspB8 inhibits the growth of genetically diverse melanoma cells that include caspase-1 activation outside of the realm of the inflammasome, mTORC1-dependent Beclin-1 upregulation and its cleavage by the activated caspase-1.
22595202 Mutant HSPB8 causes protein aggregates and a reduced mitochondrial membrane potential in dermal fibroblasts from distal hereditary motor neuropathy patients.
22302993 findings show that during heat shock recovery NF-kappaB activates selective removal of misfolded or aggregated proteins by controlling expression of BAG3 and HSPB8 and by modulating the level of the BAG3-HspB8 complex
22176143 We studied the HSPB1 and HSPB8 mutation occurrence in patients with distal hereditary motor neuropathy and those with the axonal form of Charcot-Marie-Tooth disease type 2
21985219 The results of this syudy suggested that defects in HspB8-mediated autophagy are likely to contribute to dHMNII pathology and their detection in peripheral blood mononuclear cells could be a useful, accessible biomarker for the disease.
21983727 HSPB8 may play an important role in the protection of cells under lethal heat shock treatment, and the K141N mutation can impair the protective effect.
21914495 present study demonstrates that HSPB8 is silenced by DNA methylation in hematopoietic malignant and normal cells
21767525 The complexes formed by Bag3 and HspB8 might have variable stoichiometry and can participate in different processes including clearing of the cell from improperly folded proteins.
21731611 Overexpression of HSPB1, as well as HSPB6, HSPB7 and HSPB8 independently protect against tachycardia remodeling by attenuation of the RhoA GTPase pathway at different levels.
21696420 we observed upregulation of HSPB8 and BAG3 selectively in astrocytes located within the degenerated areas of patients with protein aggregation diseases
21678403 These results demonstrated for the first time that Hsp22 regulates Sam68 expression and the ratio of Sam68 to Hsp22 may determine the proliferative potential of glioblastoma cells.
21526341 phosphorylation of HspB8 by ERK1 might be important for regulation of interaction of HspB8 with different target proteins
20858900 Drosophila HSP67Bc is the functional ortholog of human HSPB8 and Dm-HSP67Bc induces autophagy via the eIF2alpha pathway.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20570967 HspB8 increases misfolded SOD1 clearance via autophagy.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20157854 Data show that the two motor neuropathy-associated mutant HspB8 forms have abnormally increased binding to Ddx20.
19845507 Data show that the interaction between HspB6 and Bag3 requires the same regions that are involved in the HspB8-Bag3 association.
19783089 The results confirm predictions that Hsp22 belongs to the family of intrinsically disordered proteins with certain parts of its molecule retaining folded structure and undergoing reversible thermal unfolding.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19246680 Activation of the bone morphogenetic protein receptors Alk3 and Bmpr2 by H11kinase/Hsp22 promotes cardiac cell growth and survival.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18298377 Mutations in serine residues of HSP22 which are phosphorylated by cAMP-dependent protein kinase were accompanied by decrease of chaperone-like activity.
18229450 Hsp22 induction represents a new aspect of the estrogenic response with potential significance for the biology of estrogen receptor-positive breast cancer cells.
18094623 HspB8 and Bag3: a new chaperone complex targeting misfolded proteins to macroautophagy.
18006821 HSPB8 is a candidate CDK-independent cyclin D1 target that can mediate its effects
18006506 These results suggested that the HspB8-Bag3 complex might stimulate the degradation of Htt43Q by macroautophagy.
17922839 Effect of mutations in the beta5-beta7 loop on the structure and properties of human small heat shock protein HSP22
17722063 HSP22 seems to play an important role in the nervous system.
17304582 Displays chaperone activity, autokinase activity, and trigger or block apoptosis activity. Decrease may contribute to development of some neurologic diseases and others. (Review)
17173073 HspB8 overload causes melanoma growth arrest and apoptosis through TAK1 activation
17033167 Aberrant DNA methylation silences the novel heat shock protein H11 in melanoma
16935933 found aberrantly increased interactions of neuropathy-associated mutant HSP22 forms with themselves, with wild-type HSP22, and with the other sHSPs, alphaB-crystallin, and HSP27.
16795043 Results suggest that hsp22 specifically binds to Sam68 and modulates its activity, thus playing a role in the post-transcriptional regulation of gene expression.
16709864 Small heat shock protein B8 (HSP22) is a novel TLR4 agonist abundantly expressed in synovial tissue from patients with rheumatoid arthritis.
16485107 HspB8 might play important role in regulating Abeta aggregation and, therefore, development of classic senile plaques in Alzheimer's disease and cerebral amyloid angiopathy in hereditary cerebral hemorrhage with amyloidosis of Dutch type.
16225851 Our results suggest that a variety of oligomers composed of different proportions of different sHSPs may form in cell types expressing multiple sHSPs.
16086267 The rate of HSP22 gene mutation in Chinese patients with Charcot-Marie-Tooth disease is as low as 0.87%(1/115).
15879436 Reduced chaperone activity of mutated HspB8 is associated with neuromuscular disorders
15541337 Hsp22 is highly homologous to small heat shock proteins and effectively prevents aggregation of denatured protein both in vitro and in vivo. It is supposed that chaperone-like activity is of great importance for Hsp22 functioning
15122253 In two pedigrees with distal hereditary motor neuropathy type II linked to chromosome 12q24.3, we identified the same mutation (K141N) in small heat-shock 22-kDa protein 8 (encoded by HSPB8; also called HSP22).
12832417 Forced H11 expression triggers apoptosis.
12456486 H11 kinase is a novel mediator of myocardial hypertrophy in vivo
11085516 This gene is highly upregulated by estradiol treatment in breast cancer cells. It is overexpressed in estrogen receptor (ER) positive breast cancer cell lines and transcript is not detected in ER negative cell lines.

AA Sequence

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP      1 - 70
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT     71 - 140
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT                  141 - 196
//

Text Mined References (90)

PMID Year Title
26718575 2016 Mutations in HSPB8 causing a new phenotype of distal myopathy and motor neuropathy.
26694816 2015 Small heat shock proteins are induced during multiple sclerosis lesion development in white but not grey matter.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26496431 2015 A Role for the Chaperone Complex BAG3-HSPB8 in Actin Dynamics, Spindle Orientation and Proper Chromosome Segregation during Mitosis.
25731856 2015 Regulation by heat shock protein 22 (HSPB8) of transforming growth factor-?-induced ovary cancer cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
25051369 2014 The small heat shock protein B8 (HSPB8) confers resistance to bortezomib by promoting autophagic removal of misfolded proteins in multiple myeloma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24804817 2014 Heat shock protein 22 overexpression is associated with the progression and prognosis in gastric cancer.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22898869 2012 Restored expression of the atypical heat shock protein H11/HspB8 inhibits the growth of genetically diverse melanoma tumors through activation of novel TAK1-dependent death pathways.
22595202 2012 Mutant HSPB8 causes protein aggregates and a reduced mitochondrial membrane potential in dermal fibroblasts from distal hereditary motor neuropathy patients.
22366786 2012 Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy.
22302993 2012 NF-?B regulates protein quality control after heat stress through modulation of the BAG3-HspB8 complex.
22176143 2011 HSPB1 and HSPB8 in inherited neuropathies: study of an Italian cohort of dHMN and CMT2 patients.
21985219 2011 HspB8 mutation causing hereditary distal motor neuropathy impairs lysosomal delivery of autophagosomes.
21983727 2011 [The effect of HSPB8 gene mutation on cell viability in Charcot-Marie-Tooth disease type 2L].
21914495 2012 HSPB8 is methylated in hematopoietic malignancies and overexpression of HSPB8 exhibits antileukemia effect.
21767525 2011 Biochemical characterization of small heat shock protein HspB8 (Hsp22)-Bag3 interaction.
21731611 2011 HSPB1, HSPB6, HSPB7 and HSPB8 protect against RhoA GTPase-induced remodeling in tachypaced atrial myocytes.
21696420 2012 The HSPB8-BAG3 chaperone complex is upregulated in astrocytes in the human brain affected by protein aggregation diseases.
21678403 2011 Hsp22 (HspB8/H11) knockdown induces Sam68 expression and stimulates proliferation of glioblastoma cells.
21526341 2011 Phosphorylation of human small heat shock protein HspB8 (Hsp22) by ERK1 protein kinase.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20858900 2010 Identification of the Drosophila ortholog of HSPB8: implication of HSPB8 loss of function in protein folding diseases.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20570967 2010 The small heat shock protein B8 (HspB8) promotes autophagic removal of misfolded proteins involved in amyotrophic lateral sclerosis (ALS).
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20157854 2010 Abnormal interaction of motor neuropathy-associated mutant HspB8 (Hsp22) forms with the RNA helicase Ddx20 (gemin3).
19845507 2009 Identification of the key structural motifs involved in HspB8/HspB6-Bag3 interaction.
19783089 2009 Thermally induced structural changes of intrinsically disordered small heat shock protein Hsp22.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
19246680 2009 Activation of the bone morphogenetic protein receptor by H11kinase/Hsp22 promotes cardiac cell growth and survival.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18298377 2008 Phosphorylation by cyclic AMP-dependent protein kinase inhibits chaperone-like activity of human HSP22 in vitro.
18229450 2007 Induction of Hsp22 (HspB8) by estrogen and the metalloestrogen cadmium in estrogen receptor-positive breast cancer cells.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18094623 2008 HspB8 and Bag3: a new chaperone complex targeting misfolded proteins to macroautophagy.
18006821 2007 Heat shock protein B8, a cyclin-dependent kinase-independent cyclin D1 target gene, contributes to its effects on radiation sensitivity.
18006506 2008 HspB8 chaperone activity toward poly(Q)-containing proteins depends on its association with Bag3, a stimulator of macroautophagy.
17922839 2007 Effect of mutations in the beta5-beta7 loop on the structure and properties of human small heat shock protein HSP22 (HspB8, H11).
17722063 2008 Structure, properties, and functions of the human small heat-shock protein HSP22 (HspB8, H11, E2IG1): a critical review.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17304582 2007 Structure, function, property, and role in neurologic diseases and other diseases of the sHsp22.
17173073 2007 Overload of the heat-shock protein H11/HspB8 triggers melanoma cell apoptosis through activation of transforming growth factor-beta-activated kinase 1.
17033167 2006 Aberrant DNA methylation silences the novel heat shock protein H11 in melanoma but not benign melanocytic lesions.
16935933 2006 Abnormal small heat shock protein interactions involving neuropathy-associated HSP22 (HSPB8) mutants.
16795043 2006 Regulation of Sam68 activity by small heat shock protein 22.
16709864 2006 Identification of small heat shock protein B8 (HSP22) as a novel TLR4 ligand and potential involvement in the pathogenesis of rheumatoid arthritis.
16485107 2006 Small heat shock protein HspB8: its distribution in Alzheimer's disease brains and its inhibition of amyloid-beta protein aggregation and cerebrovascular amyloid-beta toxicity.
16225851 2005 Interactions of HSP22 (HSPB8) with HSP20, alphaB-crystallin, and HSPB3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16086267 2005 Mutation analysis of small heat-shock protein 22 gene in Chinese patients with Charcot-Marie-Tooth disease.
15879436 2005 HspB8, a small heat shock protein mutated in human neuromuscular disorders, has in vivo chaperone activity in cultured cells.
15565283 2005 Small heat-shock protein 22 mutated in autosomal dominant Charcot-Marie-Tooth disease type 2L.
15541337 2004 The problem of protein kinase activity of small heat shock protein Hsp22 (H11 or HspB8).
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122253 2004 Hot-spot residue in small heat-shock protein 22 causes distal motor neuropathy.
15021985 2004 A new locus for autosomal dominant Charcot-Marie-Tooth disease type 2 (CMT2L) maps to chromosome 12q24.
14985082 2004 Some properties of human small heat shock protein Hsp22 (H11 or HspB8).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594798 2004 Interaction of human HSP22 (HSPB8) with other small heat shock proteins.
12832417 2003 Forced expression of the H11 heat shock protein can be regulated by DNA methylation and trigger apoptosis in human cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456486 2002 H11 kinase is a novel mediator of myocardial hypertrophy in vivo.
11816564 2001 Phosphopeptide derivatization signatures to identify serine and threonine phosphorylated peptides by mass spectrometry.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11470154 2001 Characterization of two novel human small heat shock proteins: protein kinase-related HspB8 and testis-specific HspB9.
11342557 2001 HSP22, a new member of the small heat shock protein superfamily, interacts with mimic of phosphorylated HSP27 ((3D)HSP27).
11295034 2001 Expression analysis and chromosome location of a novel gene (H11) associated with the growth of human melanoma cells.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11180006 2001 A novel gene expressed in human keratinocytes with long-term in vitro growth potential is required for cell growth.
11085516 2000 Effects of estrogen on global gene expression: identification of novel targets of estrogen action.
10833516 2000 A novel human gene similar to the protein kinase (PK) coding domain of the large subunit of herpes simplex virus type 2 ribonucleotide reductase (ICP10) codes for a serine-threonine PK and is expressed in melanoma cells.
10777663 2000 A clone contig of 12q24.3 encompassing the distal hereditary motor neuropathy type II gene.
8817349 1996 Distal hereditary motor neuropathy type II (distal HMN II): mapping of a locus to chromosome 12q24.
8433103 1993 Dominant inherited distal spinal muscular atrophy with atrophic and hypertrophic calves.
7125978 1982 Benign familial spinal muscular atrophy with hypertrophy of the calves.
5813127 1969 A distal form of chronic spinal muscular atrophy.
3789668 1986 A rapidly progressive autosomal dominant scapulohumeral form of spinal muscular atrophy.
3022865 1986 Hereditary motor and sensory neuropathy type II. Clinicopathological study of a family.
1517763 1992 Linkage analysis of distal hereditary motor neuropathy type II (distal HMN II) in a single pedigree.