Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.10
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -4.900 7.7e-10
osteosarcoma 1.957 5.3e-03
colon cancer -1.800 1.2e-06
breast carcinoma -2.200 2.0e-03
fibroadenoma -3.200 1.4e-02
posterior fossa group B ependymoma 1.200 1.0e-04
lung adenocarcinoma -1.200 2.2e-14
ductal carcinoma in situ -4.000 2.1e-04
invasive ductal carcinoma -4.200 1.2e-03
dermatomyositis -1.800 9.5e-04
psoriasis -1.600 5.1e-47

Synonym

Accession Q9UBY9 B3KQ37 C9K0Y0 Q9NU17 HspB7
Symbols cvHSP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
25889438 HSPB7 loci is associated in the pathophysiologuy of ischemic heart failure.
24585183 Results imply that HSBP7 is likely to be a tumor suppressor gene regulated by p53 and its downregulation by hypermethylation may play a critical role in renal carcinogenesis.
22785082 HSPB7 is a potential early biomarker after MI and serves as an independent risk factor of ACS in patients with acute chest pain.
21731611 Overexpression of HSPB1, as well as HSPB6, HSPB7 and HSPB8 independently protect against tachycardia remodeling by attenuation of the RhoA GTPase pathway at different levels.
20975947 Data show a significant association between a SNP in HSPB7 gene (rs1739843, minor allele frequency 39%) and idiopathic DCM.
20975947 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20124441 The rs1738943 shows that although this SNP is located within HSPB7, it resides in a block of high LD that spans HSPB7 and a nearby gene, CLCNKA, which encodes a voltage-sensitive chloride channel expressed mainly in the kidney.
20038796 Cardiac signaling genes exhibit unexpected sequence diversity in sporadic cardiomyopathy, revealing HSPB7 polymorphisms associated with disease.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19464326 HSPB7 constitutively localized to SC35 splicing speckles, driven by its N-terminus. Unlike HSPB1 and HSPB5, that chaperoned heat unfolded substrates and kept them folding competent, HSPB7 did not support refolding.

AA Sequence

MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPG      1 - 70
GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA     71 - 140
LREDGSLTIRARRHPHTEHVQQTFRTEIKI                                            141 - 170
//

Text Mined References (20)

PMID Year Title
25889438 2015 Involvement of BAG3 and HSPB7 loci in various etiologies of systolic heart failure: Results of a European collaboration assembling more than 2000 patients.
25416956 2014 A proteome-scale map of the human interactome network.
24585183 2014 Downregulation of the tumor suppressor HSPB7, involved in the p53 pathway, in renal cell carcinoma by hypermethylation.
22785082 2012 Association of plasma concentration of small heat shock protein B7 with acute coronary syndrome.
21731611 2011 HSPB1, HSPB6, HSPB7 and HSPB8 protect against RhoA GTPase-induced remodeling in tachypaced atrial myocytes.
20975947 2010 Genetic association study identifies HSPB7 as a risk gene for idiopathic dilated cardiomyopathy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20124441 2010 Common variants in HSPB7 and FRMD4B associated with advanced heart failure.
20038796 2010 Cardiac signaling genes exhibit unexpected sequence diversity in sporadic cardiomyopathy, revealing HSPB7 polymorphisms associated with disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594798 2004 Interaction of human HSP22 (HSPB8) with other small heat shock proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10593960 1999 Identification and characterization of cvHsp. A novel human small stress protein selectively expressed in cardiovascular and insulin-sensitive tissues.