Property Summary

NCBI Gene PubMed Count 68
PubMed Score 725.66
PubTator Score 49.37

Knowledge Summary

Patent

No data available

Synonym

Accession Q16082 Q6I9U7 HspB2
Symbols MKBP
HSP27
Hs.78846
LOH11CR1K

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (54)

PMID Text
26782567 Three of the differentially expressed heat-schock proteins, HSP90A, HSPB1, and HSPB2, are up-regulated in giant cell tumor of bone patients.
26465331 HspB2 has roles in maintaining ATP levels and as well as chaperone-dependent functions for metabolic homeostasis
24985029 Results suggest a limited function of alphaB-crystallin and HSP27 in preventing abnormal tau protein deposition in glial cells and neurons; in addition, the expression of alphaB-crystallin phosphorylated at Ser59 may act as a protective factor in glial cells.
24859470 These findings provide novel insights into the role of p53 as a regulator of bidirectional gene pair HspB2/alpha B-crystallin-mediated ROS and the Warburg effect
22272249 Study shows that HspB2 oligomers exchange subunits.
21258768 promoter methylation of heat shock protein B2 is a novel molecular biomarker in human esophageal squamous cell carcinoma
20592365 analysis of CEA-, Her2/neu-, BCRP- and Hsp27-positive microparticles in breast cancer patients
20456980 Hsp27, but not the classic Hsp60 and Hsp70, may be associated with the development bronchiolitis obliterans syndrome.
20378664 Observational study of gene-disease association. (HuGE Navigator)
20336542 The abnormal expression of 14-3-3 sigma and HSP27 is significantly associated with lymph node metastasis in colorectal cancer.
20101233 HSP27 confers reresistance to androgen ablation and chemotherapy in prostate cancer cells through eIF4E
20087649 Reveal a novel function of HspB2 as an anti-apoptotic protein that negatively regulates apical caspase 3/8 activation in the extrinsic apoptotic pathway.
20065497 study indicate that monocytes do not trigger apoptosis of vascular endothelial cells; proapoptotic activation mediated by PUMA seemed to be counterbalanced by significant increase of antiapoptotic HSP70, HSP27 and especially phospho-HSP27 proteins level
20043073 HSP27 and p53 protein levels play a key role(s) in heat shock-mediated switch of glucose depreivation-induced necrosis to apoptosis.
19930842 Small interfering RNA-mediated silencing of heat shock protein 27 (HSP27) Increases chemosensitivity to paclitaxel by increasing production of reactive oxygen species in ovarian cancer.
19901540 5-fluorouracil & carboplatin specifically induce expression of Hsp27 in hepatoma cells. siRNA knockdown of Hsp27 diminishes survival of drug-exposed cells.
19680556 Observational study of gene-disease association. (HuGE Navigator)
19656912 Overexpression of huHSP27 protects against hepatic injury and acute kidney injury associated with liver ischemia-reperfusion injury in mice.
19520919 PM induces ROS generation in human lung endothelium, resulting in oxidative stress-mediated EC barrier disruption via p38 MAPK- and HSP27-dependent pathways.
19513626 Sodium salicylate can induce the expression of HSP27 in human lens epithelial cells.
19429074 findings provide the first evidence that expanded ataxin-3 interferes with Hsp27 synthesis, which may contribute to the impairment of the cells' ability to respond to stresses and trigger the progression of Machado-Joseph disease
19331697 Findings revealed a possible effect of HSP27 on apoptosis in metastatic HCC cells, in which HSP27 may regulate NF-kB pathway activation.
19325007 data show islet protection in mice by human HSP27 by mitigation of apoptosis, possibly through nuclear factor kappaB regulation.
19238749 the differential expression patterns of alphaB-crystallin and Hsp27 indicate functional differences between these highly related proteins in placental tissues.
19224398 show that Hsp27 and actin are in the same complex in cells and that Hsp27 is important for cell motility.
19132982 HSP27 and HSP60 are predictors of biochemical recurrence of prostate cancer after radical prostatectomy.
18755499 Overexpression of HSP27 in squamous cell carcinoma of the uterine cervix: a proteomic analysis using archival formalin-fixed, paraffin-embedded issues is reported.
18701018 Pint mutations in patients with type 2 diabetes and their families were studied. mitochondrial genes including np3316, np3394 and np3426 in the ND1 region and np3243 in the tRNA(Leu(UUR))were screened.
18651163 mRNA expressions of Hsp70, Hsp32 and Bax significantly increased in mononuclear blood cells after marathon running, whereas Hsp27 and Bad mRNA expression levels showed no significant changes.
18624915 In conclusion, despite the protective action against acute motor neuron injury, Hsp27 alone is not sufficient to protect against the chronic motor neuron injury due to the presence of mutant SOD1.
18566345 Mechanistic in vitro studies showed upregulated HSP27 expression and secretion in human macrophages treated with estrogen or acLDL.
18494762 annexin II is a novel HSP27-interacted protein which is involved in UVC resistance in human cells
18471985 HSP27 phosphorylation is correlated with ADP-induced platelet granule secretion.
18440775 These findings identify a novel pathway for vascular endothelial growth factor-induced HSP27 serine 82 phosphorylation via PKC-mediated PKD activation and direct phosphorylation of HSP27 by PKD.
18390793 In a large cohort of type 1 diabetic subjects, we found an independent association between serum HSP27 and distal symmetrical polyneuropathy.
18387368 Upon heating at 43 degrees C, Hsp27 effectively suppresses myosin subfragment 1 aggregation, and this effect is enhanced by mutations mimicking Hsp27 phosphorylation.
18299320 These data show that Hsp27 antagonizes Bax-mediated mitochondrial injury and apoptosis by promoting Akt activation via a PI3-kinase-dependent mechanism.
18061943 a cellular defense against dysregulated proteins, in the form of Hsp27 and alphaB-crystallin, might contribute to the cell cycle reentry seen in AD cells.
17916352 positive effect of Id-1 on TGF-beta1-induced cell motility was mediated through activation of MEK-ERK signaling pathway and subsequent phosphorylation of HSP27
17524270 HSP27 is linked to multi-drug resistance in cell line HepG2/VCR.
16598923 Both heat and BPDE can induce the expressions of Hsp27 and Hsp70 in A549 cells.
16598774 KNG modulate bone marrow derived stromal/preosteoblast cell proliferation and suppress etoposide-induced apoptosis through ERK and HSP27 activation, respectively.
14963027 HSP27 may provide a neuroprotective effect in AD and other tauopathies
14729728 Phosphorylated HSP27 favors reduced bead motions that are probably due to stabilization of the actin cytoskeleton.
12897149 HSP27 is a ubiquitin-binding protein involved in I-kappaBalpha proteasomal degradation
12832059 down regulation in neuronal and non-neuronal cells expressing mutant ataxin-3
12829720 Associates with the I kappa B kinase complex regulates tumor necrosis factor alpha-induced NF-kappa B activation.
12748284 Data show that heat shock protein 72 suppressed extracellular signal-regulated kinase activation by protecting dual-specificity phosphatases and suppressing MEK1/2.
12700631 Hsp27 plays a significant role in the IFN-gamma-induced sensitization of oral SCC cells to anticancer drugs
12611892 hsp72 reduces caspase-3-mediated proteolysis of FAK, an anti-apoptotic protein
12510153 Hsp27 regulates apoptosis through an ability to interact with key components of the apoptotic signalling pathway [review]
12503731 HSP72 biosynthesis was analyzed by an image processing, computer-assisted imaging method in an endothelial vascular cell line and compared to a hand-calculated method. No differences were seen.
12473058 HSP27 nuclear staining can serve as a sensitive marker for skin irritation or cellular stress in excised skin
11926998 HSP27 and alphaB-crystallin are increased, phosphorylated and localized in aggresomes when proteasome activity is inhibited

AA Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS      1 - 70
EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG     71 - 140
ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP                                141 - 182
//

Text Mined References (68)

PMID Year Title
26782567 2015 Potential role of heat-shock proteins in giant cell tumors.
26465331 2015 Characterization of the Cardiac Overexpression of HSPB2 Reveals Mitochondrial and Myogenic Roles Supported by a Cardiac HspB2 Interactome.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
24985029 2014 ?B-crystallin and HSP27 in glial cells in tauopathies.
24859470 2014 As a novel p53 direct target, bidirectional gene HspB2/?B-crystallin regulates the ROS level and Warburg effect.
22272249 2012 HspB2/myotonic dystrophy protein kinase binding protein (MKBP) as a novel molecular chaperone: structural and functional aspects.
21258768 2011 Promoter methylation of heat shock protein B2 in human esophageal squamous cell carcinoma.
20592365 2010 CEA-, Her2/neu-, BCRP- and Hsp27-positive microparticles in breast cancer patients.
20456980 2010 The role of heat shock protein 27 in bronchiolitis obliterans syndrome after lung transplantation.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
20336542 2010 [Expression and clinical significance of 14-3-3 sigma and heat shock protein 27 in colorectal cancer].
20101233 2010 Heat shock protein 27 confers resistance to androgen ablation and chemotherapy in prostate cancer cells through eIF4E.
20087649 2010 The small heat shock protein HspB2 is a novel anti-apoptotic protein that inhibits apical caspase activation in the extrinsic apoptotic pathway.
20065497 2009 Monocytes and vascular endothelial cells apoptosis. Role of p-HSP27.
20043073 2010 Implication of PI3K-dependent HSP27 and p53 expression in mild heat shock-triggered switch of metabolic stress-induced necrosis to apoptosis in A549 cells.
19930842 Small interfering RNA-mediated silencing of heat shock protein 27 (HSP27) Increases chemosensitivity to paclitaxel by increasing production of reactive oxygen species in human ovarian cancer cells (HO8910).
19901540 2009 Inhibition of Hsp27 and Hsp40 potentiates 5-fluorouracil and carboplatin mediated cell killing in hepatoma cells.
19680556 2009 Genetic variation in healthy oldest-old.
19656912 2009 Human heat shock protein 27-overexpressing mice are protected against acute kidney injury after hepatic ischemia and reperfusion.
19520919 2010 Particulate matter disrupts human lung endothelial barrier integrity via ROS- and p38 MAPK-dependent pathways.
19513626 2009 Effects of mitogen-activated protein kinase signal pathway on heat shock protein 27 expression in human lens epithelial cells exposed to sodium salicylate in vitro.
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
19429074 2009 Decreased protein synthesis of Hsp27 associated with cellular toxicity in a cell model of Machado-Joseph disease.
19331697 2009 Regulation of HSP27 on NF-kappaB pathway activation may be involved in metastatic hepatocellular carcinoma cells apoptosis.
19325007 2009 Heat shock protein 27 overexpression mitigates cytokine-induced islet apoptosis and streptozotocin-induced diabetes.
19238749 2008 Expression of the small heat shock protein alphaB-crystallin in term human placenta.
19224398 2009 The role of Hsp27 and actin in the regulation of movement in human cancer cells responding to heat shock.
19132982 2008 Heat shock proteins 27, 60 and 70 as prognostic markers of prostate cancer.
18755499 2009 Overexpression of heat shock protein 27 in squamous cell carcinoma of the uterine cervix: a proteomic analysis using archival formalin-fixed, paraffin-embedded tissues.
18701018 2008 Mitochondrial gene mutations and type 2 diabetes in Chinese families.
18651163 2008 Effects of ultra-marathon on circulating DNA and mRNA expression of pro- and anti-apoptotic genes in mononuclear cells.
18624915 2008 Over-expression of Hsp27 does not influence disease in the mutant SOD1(G93A) mouse model of amyotrophic lateral sclerosis.
18566345 2008 Extracellular release of the atheroprotective heat shock protein 27 is mediated by estrogen and competitively inhibits acLDL binding to scavenger receptor-A.
18494762 Annexin II, a novel HSP27-interacted protein, is involved in resistance to UVC-induced cell death in human APr-1 cells.
18471985 2008 HSP27 phosphorylation is correlated with ADP-induced platelet granule secretion.
18440775 2008 Vascular endothelial growth factor induces heat shock protein (HSP) 27 serine 82 phosphorylation and endothelial tubulogenesis via protein kinase D and independent of p38 kinase.
18390793 2008 Serum heat shock protein 27 and diabetes complications in the EURODIAB prospective complications study: a novel circulating marker for diabetic neuropathy.
18387368 2008 Small heat shock protein Hsp27 protects myosin S1 from heat-induced aggregation, but not from thermal denaturation and ATPase inactivation.
18299320 2008 Hsp27 inhibits Bax activation and apoptosis via a phosphatidylinositol 3-kinase-dependent mechanism.
18061943 2008 Small heat shock proteins Hsp27 or alphaB-crystallin and the protein components of neurofibrillary tangles: tau and neurofilaments.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17916352 2007 Id-1 promotes TGF-beta1-induced cell motility through HSP27 activation and disassembly of adherens junction in prostate epithelial cells.
17524270 2007 [Heat-shock protein 27 linked to multi-drug resistance in human hepatic cancer cell lines].
16598923 2006 [Effect of heat and BPDE on the expression of Hsp27 and Hsp70 in A549 cell line].
16598774 2006 Elevated serum kininogen in patients with Paget's disease of bone: a role in marrow stromal/preosteoblast cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14963027 2004 Binding of tau to heat shock protein 27 leads to decreased concentration of hyperphosphorylated tau and enhanced cell survival.
14729728 2004 Role of heat shock protein 27 in cytoskeletal remodeling of the airway smooth muscle cell.
14594798 2004 Interaction of human HSP22 (HSPB8) with other small heat shock proteins.
12897149 2003 HSP27 is a ubiquitin-binding protein involved in I-kappaBalpha proteasomal degradation.
12832059 2003 Down-regulation of heat shock protein 27 in neuronal cells and non-neuronal cells expressing mutant ataxin-3.
12829720 2003 Heat shock protein 27 association with the I kappa B kinase complex regulates tumor necrosis factor alpha-induced NF-kappa B activation.
12748284 2003 Inactivation of dual-specificity phosphatases is involved in the regulation of extracellular signal-regulated kinases by heat shock and hsp72.
12705895 2003 Beacon interacts with cdc2/cdc28-like kinases.
12700631 2003 Interferon-gamma downregulates Hsp27 expression and suppresses the negative regulation of cell death in oral squamous cell carcinoma lines.
12611892 2003 hsp72 inhibits focal adhesion kinase degradation in ATP-depleted renal epithelial cells.
12510153 2003 On the role of Hsp27 in regulating apoptosis.
12503731 2002 Validation of image analysis for enzyme histochemical and immunocytochemical staining.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473058 2002 Induction of HSP27 nuclear immunoreactivity during stress is modulated by vitamin C.
11926998 2002 Inhibition of proteasomes induces accumulation, phosphorylation, and recruitment of HSP27 and alphaB-crystallin to aggresomes.
11697892 2001 Association of HSPB2, a member of the small heat shock protein family, with mitochondria.
11313745 2001 A high-resolution integrated map spanning the SDHD gene at 11q23: a 1.1-Mb BAC contig, a partial transcript map and 15 new repeat polymorphisms in a tumour-suppressor region.
10625651 2000 Muscle develops a specific form of small heat shock protein complex composed of MKBP/HSPB2 and HSPB3 during myogenic differentiation.
9687510 1998 Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB.
9490724 1998 MKBP, a novel member of the small heat shock protein family, binds and activates the myotonic dystrophy protein kinase.
9344664 1997 Identification and characterization of the gene encoding a new member of the alpha-crystallin/small hsp family, closely linked to the alphaB-crystallin gene in a head-to-head manner.
8227983 Muscle autoantigens in thyroid associated ophthalmopathy: the limits of molecular genetics.