Property Summary

NCBI Gene PubMed Count 14
PubMed Score 21.88
PubTator Score 6.89

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.400 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.5e-03
Polycystic Ovary Syndrome 1.063 7.9e-03
ovarian cancer -1.300 2.5e-04
dermatomyositis 1.300 6.3e-04

Protein-protein Interaction (8)

Gene RIF (3)

PMID Text
26694816 HSPB11 are induced during multiple sclerosis lesion development in white but not grey matter.
18154656 Hsp16.2 expression is directly correlated with the histological grade of brain tumors.
17275951 These data suggest that Hsp16.2 can prevent the destabilization of mitochondrial membrane systems and could represent a suitable target for modulating cell death pathways.

AA Sequence

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ      1 - 70
TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS     71 - 140
NLSS                                                                      141 - 144
//

Text Mined References (18)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26694816 2015 Small heat shock proteins are induced during multiple sclerosis lesion development in white but not grey matter.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19921466 2010 Why proteins without an alpha-crystallin domain should not be included in the human small heat shock protein family HSPB.
19253336 2009 Characterization of mouse IFT complex B.
18816799 2009 Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study.
18154656 2007 Correlation between the progressive cytoplasmic expression of a novel small heat shock protein (Hsp16.2) and malignancy in brain tumors.
17275951 2007 Preventing apoptotic cell death by a novel small heat shock protein.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2018407 1991 Isolation and characterization of five new soluble placental tissue proteins (PP22, PP23, PP24, PP25, PP26).