Property Summary

NCBI Gene PubMed Count 47
PubMed Score 84.23
PubTator Score 10.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
facioscapulohumeral dystrophy 286 8.9e-08

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.200 8.9e-08

Gene RIF (33)

PMID Text
26656590 endothelial nitric oxide synthase induces heat shock protein HSPA6 (HSP70B') in human arterial smooth muscle cells
25957766 Data indicate that heat shock protein 90kD(HSP90) inhibition induces heat shock 70kD protein 6 (HSP70B') expression.
25798051 High BCLC staging scores, advanced cirrhosis and the overexpression of HSPA12A and HSP90B1 might be associated with poor survival from HCC, whereas high levels of HSPA4, HSPA5 and HSPA6 might be associated with earlier recurrence of HCC
25447897 HSPA6 regulation by TNIP1 occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors
25319762 Potential stress-sensitive sites were identified in differentiated human SH-SY5Y cells by the localization of HSPA6 (HSP70B') and HSPA1A (HSP70-1) to nuclear components following heat shock
24742347 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
24061851 Following a brief period of thermal stress, YFP-tagged HSPA6 and HSPA1A rapidly appeared at centrioles in the cytoplasm of human neuronal cells.
22190034 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
21763498 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
21738476 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20348092 Heat shock protein 70B' (HSP70B') expression and release in response to human oxidized low density lipoprotein immune complexes in macrophages.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20084477 Hsp70B' also formed complexes with Hsp40 suggesting a common co-chaperone for HSP70 family members.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19275587 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
19074885 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18579131 Hsp70B' and Hsp72 play cooperative roles in cell survival of proteotoxic stress.
18372927 higher expression of HSPA6 & HSPA1A was exhibited in placental vascular disease (PVD)subjects compared to normal pregnancy; significant upregulation of HSP70 mRNA & protein in placental tissue & microvascular endothelial cells of PVD subjects was observed
18347947 Hsp70B' expressed on colon cells after proteasome inhibition was most closely related to Hsp72. They shared 100% AA identity in the peptide-binding region but differed in the lid and C-terminal domains.Hsp70B' appeared to have diverged recently.
18229458 These findings are likely to be important in pathological conditions in which Hsp70B' contributes to cell survival.
17601350 Observational study of gene-disease association. (HuGE Navigator)
12832005 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
11932435 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
10964507 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
10617616 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
7906708 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages

AA Sequence

MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVF      1 - 70
DAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQP     71 - 140
VKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVS    141 - 210
VLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSST    211 - 280
QATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQK    281 - 350
LLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA    351 - 420
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSV    421 - 490
TATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESL    491 - 560
RDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQ    561 - 630
GDPSTGPIIEEVD                                                             631 - 643
//

Text Mined References (49)

PMID Year Title
26656590 2016 Endothelial nitric oxide synthase induces heat shock protein HSPA6 (HSP70B') in human arterial smooth muscle cells.
26001115 2015 The Broad-Spectrum Antiviral Protein ZAP Restricts Human Retrotransposition.
25957766 2015 Induction of heat shock protein HSPA6 (HSP70B') upon HSP90 inhibition in cancer cell lines.
25798051 2015 Upregulation of heat shock proteins (HSPA12A, HSP90B1, HSPA4, HSPA5 and HSPA6) in tumour tissues is associated with poor outcomes from HBV-related early-stage hepatocellular carcinoma.
25447897 2015 TNIP1 reduction of HSPA6 gene expression occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors.
25319762 2014 Localization of heat shock protein HSPA6 (HSP70B') to sites of transcription in cultured differentiated human neuronal cells following thermal stress.
24061851 2014 Stress-induced localization of HSPA6 (HSP70B') and HSPA1A (HSP70-1) proteins to centrioles in human neuronal cells.
24039173 2013 Genetic predictors of risk and resilience in psychiatric disorders: a cross-disorder genome-wide association study of functional impairment in major depressive disorder, bipolar disorder, and schizophrenia.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23652523 2013 Identification of genetic loci associated with Helicobacter pylori serologic status.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21597468 2011 Transformation of eEF1B? into heat-shock response transcription factor by alternative splicing.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20348092 2010 Heat shock protein 70B' (HSP70B') expression and release in response to human oxidized low density lipoprotein immune complexes in macrophages.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20084477 2010 Heteromeric complexes of heat shock protein 70 (HSP70) family members, including Hsp70B', in differentiated human neuronal cells.
20072699 2010 Crystal structures of the ATPase domains of four human Hsp70 isoforms: HSPA1L/Hsp70-hom, HSPA2/Hsp70-2, HSPA6/Hsp70B', and HSPA5/BiP/GRP78.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18579131 2008 Hsp70B' and Hsp72 form a complex in stressed human colon cells and each contributes to cytoprotection.
18372927 HSP70 is associated with endothelial activation in placental vascular diseases.
18347947 2008 Surface expression of Hsp70B' in response to proteasome inhibition in human colon cells.
18229458 2007 Hsp70B' regulation and function.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11932435 2002 Specific incorporation of heat shock protein 70 family members into primate lentiviral virions.
10964507 2000 Heat-shock protein 70 can replace viral protein R of HIV-1 during nuclear import of the viral preintegration complex.
10617616 2000 Requirement for a kinase-specific chaperone pathway in the production of a Cdk9/cyclin T1 heterodimer responsible for P-TEFb-mediated tat stimulation of HIV-1 transcription.
10413683 1999 Human heat shock factor 1 is predominantly a nuclear protein before and after heat stress.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7545947 1994 Phylogenetic analysis of the stress-70 protein family.
3184191 1988 Cis-acting elements involved in the regulated expression of a human HSP70 gene.
2327978 1990 The human heat-shock protein family. Expression of a novel heat-inducible HSP70 (HSP70B') and isolation of its cDNA and genomic DNA.
1346391 1992 The human heat-shock genes HSPA6 and HSPA7 are both expressed and localize to chromosome 1.