Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.15
PubTator Score 12.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.600 5.1e-03
psoriasis 1.600 1.4e-08
glioblastoma -2.500 7.5e-05
atypical teratoid / rhabdoid tumor -1.500 3.6e-02
medulloblastoma -1.500 1.2e-03
medulloblastoma, large-cell -2.000 2.1e-06
primitive neuroectodermal tumor -1.200 3.3e-03
non-small cell lung cancer 1.496 1.7e-12
lung cancer 1.500 1.5e-02
pediatric high grade glioma -2.000 4.1e-05
pilocytic astrocytoma -1.800 7.7e-06
lung carcinoma 2.500 6.0e-16
Pick disease -1.400 3.8e-03
Breast cancer -2.100 1.5e-10

Gene RIF (6)

PMID Text
26486082 Findings indicate that miR-497 is a potent tumor suppressor that inhibits cancer phenotypes by targeting ANLN and HSPA4L in NPC.
24091676 HSP40 and HSP110 function together in protein homeostasis control.
23509252 Human molecular chaperone Hsp110 rescues a vesicle transport defect produced by an ALS-associated mutant SOD1 protein in squid axoplasm.
21946539 Expression of a mutant HSP110 sensitizes colorectal cancer cells to chemotherapy and improves disease prognosis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
12952923 a novel autocrine pathway of CD1d regulation by Hsp110.

AA Sequence

MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFKKL      1 - 70
HGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADC     71 - 140
VISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRNVVFIDMGHSAYQV    141 - 210
LVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSAN    211 - 280
ASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSIEIVGGATRIPAV    281 - 350
KEQITKFFLKDISTTLNADEAVARGCALQCAILSPAFKVREFSITDLVPYSITLRWKTSFEDGSGECEVF    351 - 420
CKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDARIGSFTIQNVFPQSDGDSSKVKVKVRVNIHGIF    421 - 490
SVASASVIEKQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSA    491 - 560
VSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSYIENEGKMIMQDKLEKERNDAKNAVEEYVYD    561 - 630
FRDRLGTVYEKFITPEDLSKLSAVLEDTENWLYEDGEDQPKQVYVDKLQELKKYGQPIQMKYMEHEERPK    631 - 700
ALNDLGKKIQLVMKVIEAYRNKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSE    701 - 770
IVAKSKELDNFCNPIIYKPKPKAEVPEDKPKANSEHNGPMDGQSGTETKSDSTKDSSQHTKSSGEMEVD     771 - 839
//

Text Mined References (20)

PMID Year Title
26486082 2015 The potent tumor suppressor miR-497 inhibits cancer phenotypes in nasopharyngeal carcinoma by targeting ANLN and HSPA4L.
24091676 2013 Suppression of polyglutamine protein toxicity by co-expression of a heat-shock protein 40 and a heat-shock protein 110.
23509252 2013 Molecular chaperone Hsp110 rescues a vesicle transport defect produced by an ALS-associated mutant SOD1 protein in squid axoplasm.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21946539 2011 Expression of a mutant HSP110 sensitizes colorectal cancer cells to chemotherapy and improves disease prognosis.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19169850 2009 Molecular cloning of OSP94: A significant biomarker protein of hypertensive human heart and a member of HSP110 family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17588478 2007 Identification of an overexpressed gene, HSPA4L, the product of which can provoke prevalent humoral immune responses in leukemia patients.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12952923 2003 Intestinal heat shock protein 110 regulates expression of CD1d on intestinal epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11389747 2001 Expression of Apg-1, a member of the Hsp110 family, in the human testis and sperm.
10524232 1999 Cloning of human cDNAs for Apg-1 and Apg-2, members of the Hsp110 family, and chromosomal assignment of their genes.