Property Summary

NCBI Gene PubMed Count 251
PubMed Score 8441.31
PubTator Score 3498.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.222 3.4e-03
Multiple myeloma 1.598 6.6e-04
ependymoma 1.400 2.7e-02
oligodendroglioma 1.200 6.9e-03
psoriasis 2.200 1.5e-03
osteosarcoma 1.702 3.0e-03
cystic fibrosis -1.109 1.2e-04
glioblastoma 1.600 1.3e-02
atypical teratoid / rhabdoid tumor 1.300 6.8e-05
medulloblastoma, large-cell 1.600 4.0e-04
adrenocortical carcinoma 1.154 1.6e-02
non-small cell lung cancer 1.180 1.6e-09
lung cancer 1.300 1.3e-04
diabetes mellitus -1.100 1.1e-03
pediatric high grade glioma -1.100 3.9e-05
group 3 medulloblastoma 1.100 3.9e-03
non primary Sjogren syndrome sicca 1.100 2.5e-02
subependymal giant cell astrocytoma 1.778 5.1e-03
lung adenocarcinoma 1.095 7.7e-06
Pick disease 1.400 4.6e-03
ovarian cancer 3.500 7.9e-08
Gaucher disease type 1 -1.600 2.2e-02

 GO Function (1)

Gene RIF (241)

PMID Text
26565746 Both intrinsic affinity and post-translational modifications tune the interactions between the Hsp70 and Hsp90 proteins and the tetratricopeptide repeat (TPR) domain-containing cochaperones.
26559972 HSP70 suppression elevates FOXM1 expression, and simultaneous inhibition of FOXM1 and HSP70 increases the sensitivity of human cancer cells to anticancer drug-induced apoptosis.
26556859 Data suggest that dual heat shock proteins HSP90 and HSP70 inhibition can simultaneously disrupt the key signaling pathways in muscle invasive bladder cancer (MIBC).
26446645 Hsp70 overexpression likely plays an important role in the excessive collagen production by keloid fibroblasts. RNA interference has therapeutic potential for the treatment of keloids.
26439956 This study demonstrated that Heat shock protein 70 (Hsp70) interacts with the Notch1 intracellular domain and contributes to the activity of Notch signaling in myelin-reactive.
26286954 Data show that binding of heat shock proteins Hsp70 and Hsp90 requires prior binding of Hop protein to Hsp90.
26246424 As a chaperone of heat shock protein 70 (HSP70), HBP21 could inhibit interaction between HSP70 and Bax, increased Bax protein translocation from cytoplasm to mitochondria.
26183779 Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine.
26165468 AIF bears a HSP-70 binding domain allowing association with HSP-70.
26050647 quercetin-induced inhibition is involved in growth inhibition and sensitization to chemotherapy in lung cancer cells
25881670 Studies indicate the role of 70 kDa heat-shock protein (HSP70) in the activation of NADPH oxidase isoforms and in islet alpha- and beta-cell physiological function in health and Type 2 diabetes mellitus.
25864199 Thus, isoform-selective targeting of Hsc70 could be a viable therapeutic strategy for tauopathies and possibly lead to new insights in chaperone complex biology.
25857363 heat stress(HS) and aspirin + HS does not act as a co-inducer of HSP70 in HepG2 cells, but promotes Bcl-2 protein expression during prolonged treatment
25798051 High BCLC staging scores, advanced cirrhosis and the overexpression of HSPA12A and HSP90B1 might be associated with poor survival from HCC, whereas high levels of HSPA4, HSPA5 and HSPA6 might be associated with earlier recurrence of HCC
25789959 serum level associated with severity of alcoholic fatty liver disease
25772468 Here we describe the small molecule, apoptozole (Az), which inhibits the ATPase activity of HSP70 by binding to its ATPase domain
25697138 TLR4-ligand lipopolysaccharide (LPS) stimulate the TLR and up-regulate IFN-gamma skewing the cells towards type 1 polarization and heat shock protein (Hsp)70 down-regulated TLR4 augmenting the anti-inflammatory cytokine IL-10.
25687737 These findings suggest that HSP70 genes are dependent of HLA-DR/DQ loci in governing susceptibility to PF. The multivariant regression analysis confirms this hypothesis.
25655005 regulates the expression of SDF-1 and Twist in fibroblasts, thereby controlling gastric ulcer healing
25600910 Data suggest that secretion of HSP70 and IL1B (interleukin 1 beta) by fetal membranes is up-regulated during chorioamnionitis/infection with Escherichia coli; secretion of HSP70, IL1B, and HSP60 follow different temporal patterns.
25437815 High expression of HSPA4 is associated with colorectal cancers.
25429623 Cells overexpressing HSP70 had higher levels of miR-23a, maintained these levels after heat shock and accumulated lower levels of NOXA mRNA and protein.
25347739 Studies indicate that heat shock protein Hsp70 (Hsp70) regulates multiple pathways in cancer cells via interaction with Bcl2-associated athanogene 3 protein (BAG3) co-chaperone.
25261232 Hsp70 is a positive predictive factor in completely resected NSCLC with received platinum-based adjuvant chemotherapy.
25175595 Findings suggest a novel function of HSP70/MRJ/uPAR complex in cell adhesion, invasion and migration, and may provide more understanding in the mechanisms of uPAR-mediated cancer metastasis.
25156257 during the maturation of beta-thalassaemia major erythroblasts, HSP70 interacts directly with free alpha-globin chains; consequently HSP70 is sequestrated in the cytoplasm and GATA-1 is no longer protected, resulting in end-stage maturation arrest and apoptosis
25095651 HSP70 is an index of severity of lesion and activation of kidney self-defense mechanisms in patients with chronic glomerulonephritis (CGN). Serum HSP70 antibodies may be used to assess the prognosis of CGN.
24934530 This review summarizes recent data regarding immunoregulatory properties of Hsp70, and presents promising results of the studies concerning the application of heat shock proteins in treatment of chronic inflammatory diseases.
24923353 14-3-3sigma alone or combined with HSP70 are potential prognostic biomarkers for HCC
24876225 BAG-1M mediates Hsp70 inhibition downstream of NF-kappaB.
24846187 Baicalein treatment upregulated the expression of HSP70, which partially prevented human osteosarcoma cells from undergoing apoptosis.
24786389 results showed higher expression of HSP70 and LOX-1 in the placental tissues of pre-eclampsia patients which represent the possible contribution of these molecules in the disease pathogenesis.
24742079 HSP70 is induced in polymorphonuclear cells of ulcerative colitis patients and its induction correlates with depression and anxiety levels.
24718854 With HSP90 suppression, HSP70 overexpression possibly contributes to the avoidance of cell death and HSP70 may be a key molecule for overcoming resistance to the HSP90 inhibitor
24715760 The purpose of this study was to investigate the co-expression patterns of transcription factor HIF-1alpha and von Hippel Lindau protein (pVHL) and heat shock proteins in pterygium and normal conjunctival human samples.
24660549 These results provide an explanation for the elevated serum levels of HSP-27, HSP-70, and ccCK-18 found in COPD patients, indicating that hypoxic conditions can trigger the release of the aforementioned factors.
24501795 Positive reactions on the presence of the HSP-70 protein in circulating immune complexes isolated from sera of smoking patients with lung cancer was confirmed.
24492285 BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T cell lymphoma cases co-expressing the CD30 antigen.
24480410 The organelle distribution of Hsp70 is determined by their specific lipid compositions.
24474693 Hsp70 may act as a chaperone for influenza virus polymerase, and the modulatory effect of Hsp70 appears to be a sequel of shuttling of Hsp70 between nuclear and cytoplasmic compartments
24449167 Glutamine regulated ubiquitination processes of Grp75 and Apg-2.
24425585 HSP70 could be an important antigen in balancing the healthy immune system. T cell recognition of naturally presented epitopes of self-heat shock protein 70 is demonstrated.
24376495 HSP70 induced IL-10 production in eyes from wild-type mice but was impaired in both TLR2- and TLR4-deficient mice.
24355684 PTSD and exposure to trauma are not related to changes in lymphocyte MR, Hsp90 or Hsp70 levels, but may be associated with disturbances in corticosteroid receptors interaction with heat shock proteins.
24354861 Expression of inducible HSP70 were compared in skin samples, evaluated the viability of primary vitiligo and control melanocytes exposed to bleaching phenols, and measured secreted indcible HSP70.
24347824 Increased circulating level of HSP60 and HSP70 might play a role in initiation and/or progression of atherosclerosis in CKD subjects through perturbation of CD4(+)CD28(null) cells.
24327239 In postmenopausal women, serum HSP60 and anti-HSP70 concentrations increased with accumulating features of the metabolic syndrome. Results suggest an immune activation associated with cardiovascular risk in postmenopausal women with metabolic syndrome.
24252366 Results suggest a role for HSP70 in proliferation and survival of the erythroid lineage in polycytemia vera (PV), and may represent a potential therapeutic target in myeloproliferative neoplasms especially in PV.
24243066 Hsp70 1267 A/G SNP is associated with pro-inflammatory cytokine production in healthy elderly and might represent a possible determinant of individual susceptibility to inflammatory diseases.
24206096 CAMKIIgamma, HSP70 and HSP90 transcripts are differentially expressed in chronic myeloid leukemia cells from patients with resistant mutated disease.
24189052 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
24095952 HSP70 expressed in the peripheral lung tissues is significantly increased in COPD and aggravated by cigarette smoking.
24086464 Heat shock protein 70 is associated with replicase complex of Japanese encephalitis virus and positively regulates viral genome replication.
24065282 Our results demonstrated that HSP70 can play a more important role in mE7 and MtHSP70 fusion DNA vaccine without the help of a signal peptide.
24051131 higher plasma levels in the early-onset preeclampsia (before 34 weeks of gestation)as compared to the late-onset one
24047968 This is the first report providing evidence that HSP70-HSP40 complex confers an innate resistance specific to HIV-1.
24021284 Spinocerebellar ataxia type 14 mutant PKC-gamma upregulates Hsp70. Hsp70 has a role in degrading mutant PKC-gamma.
24012426 The chaperone functions of heat shock protein (Hsp)70 involve an allosteric control mechanism between the nucleotide-binding domain (NBD) and polypeptide substrate-binding domain (SBD): ATP binding and hydrolysis regulates the affinity for polypeptides.
23990450 NMIIA is the master regulator of Golgi fragmentation induced by heat shock or inhibition/depletion of HSP70/90 through interaction with gylosyltransferases.
23985798 HSP70-2 A1267G is single-nucleotide polymorphisms (SNPs) that may modulate its activities, was very common (77.5%)and was significantly high among scrub typhus patients.
23973223 results demonstrate the critical role of the stress-activated Stub1-Hsp70 complex in promoting Treg cell inactivation.
23965991 Molecular chaperones (heat-shock proteins HSP90alpha and HSP70-1A) that interact with and retain partially folded A2A receptor prior to endoplasmic reticulum exit, were identified.
23962724 Results show that TDP-43 is constitutively bound to members of the Hsp40/Hsp70 family, and that heat shock-induced TDP-43 aggregation is mediated by the availability of these chaperones interacting with the inherently disordered C-terminal prion domain.
23940031 NFS1 binds preferentially to the D-state of ISCU while mtHSP70 binds preferentially to the D-state of ISCU and HSC20 binds preferentially to the S-state of ISCU.
23913168 These results suggest that HSP70 expression might be an unfavourable prognostic factor in patients with gastric carcinoma
23874478 plasma concentrations of HSP70 elevated with the progression of HF and might act as a potential screening biomarker for early diagnosis of HF.
23840795 Hsp70 oligomerization takes place through a specific interaction between the interdomain linker.
23831493 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
23831374 Mortalin mutations are not a frequent cause of early-onset Parkinson disease.
23807299 Hsp60 levels were significantly higher than those of Hsp70 in neuroepithelial tumors, while levels of both molecules were not significantly different from each other in meningeal neoplasms
23792430 Parthenolide effectively attenuated the HSP70 upregulation in A549 derived DOX-resistant cell lines.
23776617 Recombinant HSP70 may be used for the serodiagnosis of tegumentary leishmaniasis.
23737532 HSPH1 and HSPH2 are bona fide chaperones on their own that collaborate with DNAJA1 and DNAJB1 to hydrolyze ATP and unfold polypeptides and HSPA1A and HSPH1 formed a powerful molecular machinery.
23542779 These results demonstrate that the duplicated heat shock elements and HSF1 constitute the mechanism for the heavy metal response of hsp70, which is distinct from the known metal regulatory system for the metallothionein genes.
23528882 Hsp70 plays a role in DNA protection mediated by estrogen, and the DNA protection may be involved in Alzheimer's disease preventive effect from estrogen.
23425286 Both HSP27 and HSP70 impact on the biological behaviour of urothelial carcinomas of the urinary bladder.
23392055 Heat shock protein 70 gene polymorphisms are associated with aspirin-exacerbated respiratory disease in Japanese patients.
23382911 HSP 70 is expressed in a spatial manner in the placenta. Changes in HSP 70 expression occur during labor and preeclampsia but at different zones within the placenta.
23359685 Hsp70/Hsp90 chaperone machinery is involved in the assembly of the purinosome.
23352325 Up-regulation of HSP 70, in the form of its intense and diffuse expression, may be blamed in pathogenesis of vitiligo.
23276928 Intestinal cells respond to elevated temperatures or other metabolic insults by increasing expression of HSP70. HSP70 possesses a variety of functions, including protection of intestinal-mucosal integrity and normal metabolism of epithelial cells[review]
23271055 Hsp72 had greater affinity for tau than Hsc70, but Hsc70 was 30 times more abundant than Hsp72 in human and mouse brain tissue.
23212539 anti-Hsp70 antibody levels were significantly higher in metabolic syndrome cases than in control subjects.
23154057 The interactions between hypertension and HSP70 single nucleotide polymorphisms can increase the risk of cerebral ischemia in Chinese Han.
23152061 CD99-induced HSP70 expression in B and T lymphocytes.
23139789 Perturbation of the HSP70-HSP90 heat-shock protein axis stimulates degradation of endothelial VEGFR2.
23109422 Hsp70 is a posttranscriptional regulator of gene expression that binds and stabilizes selected mRNAs containing AU-rich elements
23043959 The positive feedback regulation of Hsp70 induction exists in innate immune cells.
23023377 Opposing actions of heat shock protein 90 and 70 regulate nicotinamide adenine dinucleotide phosphate oxidase stability and reactive oxygen species production.
22990868 Nuclear HSP70 directly interacts with Aurora kinase B (AURKB) in a methylation-dependent manner and promotes AURKB activity in vitro and in vivo.
22901192 Low HSP70 expression is associated with Barrett's esophagus.
22689214 role of HSP70 and 90 in modulation of JNK, ERK expression in preeclamptic placental endothelial cell
22613557 Studies suggest that GRP78, and perhaps HSP70s, are strong tumor differentiation factor receptor candidates.
22544056 direct involvement of mtHsp70 as a susceptibility factor in Parkinson's disease
22535481 High HSP70 and HSP27 expression is associated with worse clinical outcome in colon cancer.
22528773 TiO2 nanoparticles do not significantly change the protein expression levels of Grp78 and Hsp70 in A549 cells.
22443056 UVA irradiation could stimulate the activation of HSF1 and increase HSP70 protein expression in HaCaT cells, which inhibited activation of JNK, thus preventing apoptosis.
22409343 Protective role of chaperones (HSP70 and 90) in preeclampsia.
22345440 Hsp70 has a proviral function during rabies virus infection and suggest that Hsp70 is involved in at least one stage(s) of the viral life cycle, such as viral transcription, translation, and/or production.
22343013 Moreover, the levels of DnaJA1 and Hsp70 seem to play against each other with regard to tau: as DnaJA1 levels increase, tau levels are reduced, but this can be prevented if Hsp70 levels are simultaneously induced.
22294379 plasma estradiol levels may play an important role in exercise training and that the intracellular HSP70 content, a biomarker for inflammation, is affected by both estradiol levels and exercise-induced oxidative stress.
22219199 an alternative mechanism of allosteric activation for functional regulation of HSP70 by its J-domain co-chaperones
22157767 the chaperone activity differences between Hsp70s and Hsp110s
22037021 shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex
22032827 provide evidence for elevated HSP27 concentrations in serum and urine and increased HSP70 excretion levels in patients suffering from CKD
22022600 Mammalian Hsp110 (Apg-2), Hsp70 (Hsc70 or Hsp70) and Hsp40 (Hdj1) were necessary and sufficient to slowly dissolve large disordered aggregates and recover natively folded protein.
21992180 This study clearly demonstrates that HSP70/CMVpp65(495-503)-peptide complex is a potent mediator to induce stronger T-cell responses compared to antiviral peptides.
21972530 Hsp70 can reduce formaldehyde-induced damage in human bronchial epithelium cells in vitro.
21940409 Lipid rafts play a critical role in the early stage of JEV infection by concentrating the JEV E protein and HSP70 in membrane microdomains.
21839816 Data show six differentially expressed proteins were identified as HSP70, PPIA and alpha-Enolase (up-regulated) S100-A9, PIMT and beta-5 tubulin (down-regulated), most of which had been shown to play a potential role in the pathogenesis of atherosclerosis.
21775503 Hsp70 protects cells in HD by removing/sequestering two intrinsic components of protein aggregates: the polyQ itself and GAPDH.
21763498 Differential expression of Hsp40 and Hsp70 reciprocally regulates viral gene expression and replication in HIV-1 infection.
21763498 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
21750953 Down-regulated expression of HSP70 is associated with cholangiocarcinoma.
21738476 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
21725599 specific Hsp70 shRNA silencing may inhibit colon cancer growth.
21672353 There was a significant increase in HSP70 mRNA levels in response to cardiopulmonary bypass.
21639839 Chaperone activity of proteins Hsp70 and Hdj1 in human leukemia u-937 cells were increased after heat shock.
21539621 Production and uptake of inducible HSP70 by keratinocytes may critically influence the chronic course of inflammatory skin diseases.
21522149 Overexpression of Hsp70 in poorly differentiated SCC may confer both enhanced tumour cell growth and apoptosis resistance.
21480956 HSF1 and major HSP's are expressed strongly in classical Hodgkin lymphoma.
21477782 Our findings reveal an essential role of HSP70 in TGF-beta-induced epithelial-mesenchymal transition (EMT) by impeding Smad2 phosphorylation
21442384 Data show that radiofrequency ablation can lead to a release of heat shock protein 70 into the serum, and suggest that elevated heat shock protein 70 serum levels may constitute a biomarker for favorable clinical outcome.
21418859 Compared with control group, the levels of OREBP, HSP70-2 and MUC5AC in supernatant significantly increased after HBE16 cells were exposed to hypertonic media.
21403392 This study did not reveal evidence for a genetic variant of the HSP70 family with a major effect on Alzheimer's disease.
21353370 role in promoting cell survival by regulating ASK expression in pre-eclampsia
21330950 Data concluded that serum HSP70 levels are modulated according to the patient oxidant status, and increased serum HSP70 is associated to mortality in sepsis.
21299508 The expression of HSP70 and HSF1 was increased in preeclamptic subjects as compared with that in normotensive subjects.
21228271 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
21208456 a novel pathway (NBS1-HSF4b-HSPA4/HSPA14 axis) to induce migration, invasion, and transformation, suggesting the activation of multiple signaling events induced by NBS1 overexpression
21179807 TGF-beta mRNA expression positively correlated with HSP70 expression in skin fibroblasts exposed to ultraviolet B radiation.
21161074 A sharp decrease in the content of heat shock protein with a molecular weight of 70 Da were noted in placenta during exacerbation of herpesvirus infectio.
21046302 These data support a putative role for plasma Hsp70 in the development of arterial calcification.
20964628 Hsp70 has the interaction with PrPC not only in cell lysates but in the secreted exosomes.
20876215 Findings provide evidence that extracellular alpha-synuclein oligomers may represent a crucial player in the propagation of pathology in PD, with their modulation by Hsp70 representing a potential new target for therapeutic interventions.
20842208 [review] Induction of hsp70 in diabetic neuropathy confers upon neurons, and perhaps other cells of the nervous system, the ability to tolerate the stresses associated with diabetes rather than intervening in their production.
20809635 Determined are crystal structures of the C-terminal peptide-binding domain of human Hsp40 Hdj1 (CTD) and of its complex with the C-terminal octapeptide of human Hsp70, (634')GPTIEEVD(641').
20806409 Quantitative but not qualitative differences between heat shock factor 1 (HSF1) nuclear localization of multiple sclerosis patients and controls leads to the theory of HSF1 stress activation as a major cause of Hsp70 overexpression in multiple sclerosis.
20735358 Data show that HSP70, GRP78/BiP and HSP40/DnaJ each independently suppressed hA misfolding.
20731692 Epidermal mRNA expression level of heat shock protein 70 (Hsp70) was significantly up-regulated 6 hr after standardized tape stripping.
20714862 Elevated levels of plasma Hsp70 and decreased expression of Hsp70 in lymphocytes were associated with increased risk of lung cancer in coal miners.
20714140 the genetic polymorphisms in the HSP70 genes seem to be associated with the individual's susceptibility to noise-induced hearing loss in the Taiwanese population.
20632817 HSP27 and HSP70 may be used as differential markers to distinguish conventional and low grade central osteosarcoma.
20583115 Pathogenesis of both oral verrucous carcinoma and hyperplasia may be at least partially attributed to the overexpression of MDM2 protein and moderate expression of HSP 70 protein in both lesions.
20569278 The synergistic activity of two stress-inducible immunological danger signals, HSP70 and MICA/B, leads to activation and enhanced cytotoxicity of human natural killer cells against tumour cells.
20568452 The HSP70-1 b2/b2 genotype may be a predisposing genotype to coal worker's pneumoconiosis.
20498198 Allelic variants of Hsp70 are significantly associated with systemic lupus erythematosus in whites, independently of HLA-DR3, and correlate with the presence of autoantibodies to Ro and La, hence, the Hsp70 gene locus appears to be involved in SLE etiol
20426530 long-term cigarette smoking results in reduced expression in airway smooth muscle
20354811 The current understanding of inducible and constitutive Hsp70 in maintaining and protecting neuronal synaptic function under normal and stressed conditions, is discussed.
20353025 Expression of HSP70 and NFKB was elevated in patients with chronic gastritis, regardless of H. pylori status.
20300983 Findings suggest that higher Hsp70 levels or lower anti-Hsp70 antibody levels are independently associated with a higher risk of acute coronary syndrome.
20170613 The expressions of Hsp70 and HO-1 in the myocardium of patients with acute myocardial infarction were significantly higher than those in control group.
20132183 Heat shock induced Hsp70 membrane translocation in the viable cells that were able to enhance Hsp70 production upon heating, but not in the cells undergoing apoptosis.
20069064 The intron 4 polymorphism of eNOS is associated with primary open angle glaucoma (POAG), as well as primary closed angle glaucoma (PCAG), while the G+190C polymorphism in HSP70 is associated with PCAG, but not with POAG in the Pakistani population.
20026329 Data show that GM significantly suppressed refolding of firefly luciferase in the presence of HSP70 and HSP40.
20012529 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
19952398 HSP70 expression increased in nasopharyngeal carcinoma following radiotherapy.
19919883 anti-HSP70 autoantibodies in the CSF of multiple sclerosis patients may play a pathophysiological role in enhancing inflammation.
19802386 COMMD1 has a role in conjunction with HSP90beta/HSP70 in the ubiquitin and O(2)-independent regulation of HIF-1alpha
19766166 This study provides preliminary evidence that HSP-70 may play a role in the disrupted mechanisms that lead to BPD.
19766166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19764559 HSP70/HSP90 expression in nasopharyngeal carcinoma cells up regulated promptly after thermotherapy.
19758266 HSP70-hom gene polymorphisms are associated with transplant-related mortality in hematological malignancies.
19758187 Results indicate a general protective role for both HSP90 and HSP70 families in damaged muscle fibers, and a specific cytotoxic role for HSP90 in muscle fiber invasion typically associated with IBM and PM.
19716411 greater HSP70 antibody concentrations were associated with greater impact of recent negative life events anxious symptomatology depressive symptomatology and total mood disturbance
19639585 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
19635199 The mRNA and protein levels of HSP60, HSP70 and HSP90alpha, as well as their positive rates were significantly increased in colorectal cancer tissues compared with those in para-cancerous tissues.
19620938 HSP70 expression in effusions may be a prognostic marker of poor survival, with a similar role for Bcl-2 in primary carcinomas.
19604401 Phosphorylation on Ser37/Ser38 of Carboxyl-terminal modulator protein is important for the prevention of mitochondrial localization of Carboxyl-terminal modulator protein, eventually leading to cell death by binding to heat shock protein 70.
19598015 FOLFOX4 chemotherapy regimen has advantages in cases with lower HSP70 expression over those with higher HSP70 expression.
19544471 Data show that above-median EpoR, above-median Jak2, and below-median Hsp70 mRNA levels were all associated with significantly poorer Locoregional progression-free survival.
19543852 Elevation of heat shock protein 70 is associated with chronic heart failure.
19529862 The concentration of 70 kDa heat shock protein in the serum increased 1.7 times as a result of even a short-term highly intense physiological stress.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19475432 A single hemodialysis session decreased the concentrations of anti-Hsp70
19420297 Expression of hsp22 and hsp70 transgenes is partially predictive of drosophila survival under normal and stress conditions.
19275587 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
19231003 A reliable marker for the detection of hepatocellular carcinoma in liver biopsies.
19205928 There were no significant differences in serum anti-Hsp60, anti-Hsp65, and anti-Hsp70 antibody levels between the control and preeclamptic groups.
19116451 CD36 signaling inhibits the translation of heat shock protein 70 induced by oxidized low density lipoprotein through activation of peroxisome proliferators-activated receptor gamma
19069644 Thermotherapy in combination with chemotherapy showed a stronger inhibitory effect than thermotherapy or chemotherapy alone on lung tumor cell growth by activation of c-Jun N-terminal kinase and inhibition of heat shock protein70.
19026123 Serum levels of free heat shock protein 70 and anti-HSP70 are elevated in Behcet's disease
19019335 Observational study of gene-disease association. (HuGE Navigator)
19017364 The effects of HSP70 down-regulation on the unfolded protein response and a novel strategy to enhance the proapoptotic effect of quercetin by suppressing GRP78 induction simultaneously, were investigated.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18813348 Hsf1 is required for p53 nuclear importation and activation, which implies that heat shock factors play a role in the regulation of p53.
18799101 Serum Hsp70 (heat shock protein 70)levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation
18790094 mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin
18686014 Increased serum Hsp70 levels seem to reflect systemic inflammation, oxidative stress and hepatocellular injury in preeclampsia.
18651163 mRNA expressions of Hsp70, Hsp32 and Bax significantly increased in mononuclear blood cells after marathon running, whereas Hsp27 and Bad mRNA expression levels showed no significant changes.
18608178 Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.
18587674 The newly discovered interaction between HBP21 and Hsp70 suggests that HBP21 may be involved in the inhibition of progression and metastasis of tumor cells.
18550409 The structure of an Hsp110:Hsc70 nucleotide exchange complex, is reported.
18505677 Hsp70 was isolated as a putative Rictor interacting protein.
18489731 These results suggest that aging-related changes in basal Hsp70 levels in peripheral blood lymphocyte are linked to the altered frequency of lymphocyte subsets and not to increases in aged lymphocytes per se.
18456818 these data suggest that the IkappaB-alpha/NF-kappaB pathway has a critical role in the partial maturation of dendritic cells induced by recombinant HSP70.
18439902 PHAPI, CAS, and Hsp70 function together to accelerate nucleotide exchange on Apaf-1 and prevent inactive Apaf-1/cytochrome c aggregation.
18426646 The over-expressions of HSP70 and pim-1 protein/mRNA are related to tumor burden in leukemia patients.
18418731 Sequential measurement intraoperatively of the levels of the heat shock proteins HSP70 and HSP27 in the cerebrospinal fluid can predict those patients who are at greatest risk for paralysis during thoracic aneurysm surgery.
18322243 Hsp70 interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress.
18297536 Hsp70 cell surface and mRNA expression was studied in K562, Jurkat and CCRF-CEM human leukemia cell lines
18258197 The degradation of Hsp70 was significantly reduced in TAT-Hsp40-containing cells as a consequence of reduced ubiquitin-proteasome activity after oxidative injury.
18162458 HSP70 gene expression tended to be induced in the group administered Healing and Wound Emulsion following gamma-ray irradiation.
18088459 Heat shock and ADM chemotherapy both induce over expression of HSP70 and MDR1.
17988935 Results suggest that the individuals with the homozygous HSP70-1 C/C genotype among the coke-oven workers may be susceptible to DNA damage.
17802821 The expression of HSP70 was elevated in carcinoma tissues compared with para-carcinoma tissues.
17676665 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
17616937 HSP70-mediated inhibition of apoptosis seems to be of minor importance for carcinogenesis and tumor progression in renal cell carcinomas.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17580361 Authors hypothesized that differing relations between surface expression of Hsp70 on tumor cells and clinical outcomes may reflect differences in the route of metastases.
17553457 HSP60 and HSP70 released upon tissue damage might play a role in the regulation of bacteria-induced inflammation
17311516 data suggest that blood cardioplegia can induce an increment in the expression of hsp70-1, confirming its protective role in ischemia/reperfusion injury.
17278883 These findings suggest that in tumors retaining functional p53 and expressing high levels of Hsp70, TRAIL may be an effective therapy.
17278882 All of the breast cell lines examined showed Hsp70 surface expression. These results also confirm previous studies, demonstrating that Hsp70 is on the plasma membrane of tumor cell lines.
17240362 Our results suggest that the widespread accumulation of Hsc70 and Hsp70 may occur in brains with MSA, and that Hsc70 and Hsp70 may be associated with the pathogenesis of MSA.
17211576 The basal levels of Hsp32, Hsp70 and Hsp90 increased significantly with age in controls. Higher levels of Hsp32, Hsp70 and Hsp90 were noticed in patients with inflammation.
17206383 Plasminogen bound to hsps 27, 60, and 70 and Angiostatin predominantly bound to hsp 27 and to hsp 70 in a concentration- and kringle-dependent manner.
17027895 our results imply that CPm, Hsp70h and p64 act cooperatively to encapsidate a defined region of the closterovirus genome.
17012257 Coexpression of the chaperone protein Hsp70, causes alpha-synuclein to adopt a different, open conformation, but Hsp70 does not alter alpha-synuclein-alpha-synuclein interactions.
17010992 The binding of Hsp70 with PreAS only requires the substrate-binding subdomain, and the binding with AS nuclei requires the C-terminal lid subdomain as well.
16845230 Results showed HSP70 expression was inhibited in Helicobacter pylori infected MKN7 cells.
16790501 Acidic pH exposure protects HEMEC through induction of Hsps and activation of MAPK and PI3 kinase pathway.
16598923 Both heat and BPDE can induce the expressions of Hsp27 and Hsp70 in A549 cells.
16584808 Human keratinocyte-derived cells release Hsp70 in the extracellular medium through a pathway involving secretory-like granules.
16579839 specific down-regulation of HSP70 in KATO III cells occurred only in the presence of live Helicobacter pylori; a novel regulatory mechanism for H. pylori-induced HSP70-dependent apoptosis in the human gastric epithelial cell line is proposed
16248461 The overexpression of HSP70 and HSP90beta are probably correlated with the occurrence, development and prognosis of nasopharyngeal carcinoma.
15992611 Observational study of gene-disease association. (HuGE Navigator)
15950770 This study suggests that Hsp70 and Hsp90 are closely related to cytoprotection of RPE cells in response to protein phosphatase inhibition.
15818324 Polymorphism of the HSP70-hom gene is associated with the development of posttransplant complications. Recipient HSP-AA homozygous genotype is a risk factor for acute graft-versus-host disease
15529360 T cell immunity to Hsp70 and Hsp90, like Hsp60-specific immunity, can modulate arthritogenic response in adjuvant arthritis. Regulatory mechanisms induced by Hsp60, Hsp70, and Hsp90 are reinforced by an immune network that connects their reactivities.
15507967 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15378924 stress proteins in subcellular structures of cancer cells exposed to heat shock
14987991 APG-2 has a chaperone-like activity similar to Hsp110 and is overexpressed in human hepatocellular carcinoma.
12832005 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
12526792 we show that in mammals, the cytosolic chaperones Hsp90 and Hsp70 dock onto a specialized TPR domain in the import receptor Tom70 at the outer mitochondrial membrane.
12485826 induction and expression analysis after heat and physical exercise, transcriptional, protein expression, and subcellular localization
11932435 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
10964507 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
10617616 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70
7906708 HSP70 interacts with both APOBEC3G and HIV-1 Vif, which stabilizes APOBEC3G and blocks Vif-mediated degradation of APOBEC3G. The N-terminal region of Vif involves the interaction with HSP70

AA Sequence

MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRF      1 - 70
HGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDC     71 - 140
VVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQV    141 - 210
SVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSAN    211 - 280
ASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAV    281 - 350
KEKISKFFGKELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF    351 - 420
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIF    421 - 490
SVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKK    491 - 560
MDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENEGKMIMQDKLEKERNDAKNAVEEYVYEMRD    561 - 630
KLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFE    631 - 700
ELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEA    701 - 770
KIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID    771 - 840
//

Text Mined References (262)

PMID Year Title
26565746 2015 Specific Binding of Tetratricopeptide Repeat Proteins to Heat Shock Protein 70 (Hsp70) and Heat Shock Protein 90 (Hsp90) Is Regulated by Affinity and Phosphorylation.
26559972 2016 A Novel Function of Molecular Chaperone HSP70: SUPPRESSION OF ONCOGENIC FOXM1 AFTER PROTEOTOXIC STRESS.
26556859 2015 Combined inhibition of heat shock proteins 90 and 70 leads to simultaneous degradation of the oncogenic signaling proteins involved in muscle invasive bladder cancer.
26446645 2015 Hsp70 Knockdown by siRNA Decreased Collagen Production in Keloid Fibroblasts.
26439956 2015 Heat shock protein 70 (Hsp70) interacts with the Notch1 intracellular domain and contributes to the activity of Notch signaling in myelin-reactive CD4 T cells.
26286954 2015 The joining of the Hsp90 and Hsp70 chaperone cycles yields transient interactions and stable intermediates: insights from mass spectrometry.
26246424 2015 HBP21, a chaperone of heat shock protein 70, functions as a tumor suppressor in hepatocellular carcinoma.
26183779 2015 Tag7 (PGLYRP1) in Complex with Hsp70 Induces Alternative Cytotoxic Processes in Tumor Cells via TNFR1 Receptor.
26165468 2015 Heat shock protein-70 neutralizes apoptosis inducing factor in Bcr/Abl expressing cells.
26050647 2015 Quercetin Enhances Chemosensitivity to Gemcitabine in Lung Cancer Cells by Inhibiting Heat Shock Protein 70 Expression.
25881670 2015 The regulatory roles of NADPH oxidase, intra- and extra-cellular HSP70 in pancreatic islet function, dysfunction and diabetes.
25864199 2015 Isoform-selective Genetic Inhibition of Constitutive Cytosolic Hsp70 Activity Promotes Client Tau Degradation Using an Altered Co-chaperone Complement.
25857363 2015 Heat Stress Induces Extended Plateau of Hsp70 Accumulation--A Possible Cytoprotection Mechanism in Hepatic Cells.
25798051 2015 Upregulation of heat shock proteins (HSPA12A, HSP90B1, HSPA4, HSPA5 and HSPA6) in tumour tissues is associated with poor outcomes from HBV-related early-stage hepatocellular carcinoma.
25789959 2015 Changes in tumor necrosis factor-?, heat shock protein 70, malondialdehyde, and superoxide dismutase in patients with different severities of alcoholic fatty liver disease: a prospective observational study.
25772468 2015 A small molecule inhibitor of ATPase activity of HSP70 induces apoptosis and has antitumor activities.
25697138 2015 LPS stimulates and Hsp70 down-regulates TLR4 to orchestrate differential cytokine response of culture-differentiated innate memory CD8(+) T cells.
25687737 2015 Is there any relationship between polymorphism of Heat Shock Protein 70 genes and Pemphigus foliaceus?
25655005 2015 Heat shock protein A4 controls cell migration and gastric ulcer healing.
25600910 2015 Escherichia coli-induced temporal and differential secretion of heat-shock protein 70 and interleukin-1? by human fetal membranes in a two-compartment culture system.
25437815 2015 Involvement of heat shock protein a4/apg-2 in refractory inflammatory bowel disease.
25429623 2014 The elimination of miR-23a in heat-stressed cells promotes NOXA-induced cell death and is prevented by HSP70.
25416956 2014 A proteome-scale map of the human interactome network.
25347739 2015 Hsp70 in cancer: back to the future.
25261232 2014 Heat shock protein 70 as a predictive marker for platinum-based adjuvant chemotherapy in patients with resected non-small cell lung cancer.
25175595 2014 Heat shock proteins HSP70 and MRJ cooperatively regulate cell adhesion and migration through urokinase receptor.
25156257 2014 HSP70 sequestration by free ?-globin promotes ineffective erythropoiesis in ?-thalassaemia.
25095651 2014 [Investigation of 70-kDa heat shock protein in the serum and urine of patients with chronic glomerulonephritis].
24934530 2014 [Immunoregulatory properties of Hsp70].
24923353 2014 14-3-3? induces heat shock protein 70 expression in hepatocellular carcinoma.
24876225 2014 The BAG-1 isoform BAG-1M regulates keratin-associated Hsp70 chaperoning of aPKC in intestinal cells during activation of inflammatory signaling.
24846187 2014 HSP70 desensitizes osteosarcoma cells to baicalein and protects cells from undergoing apoptosis.
24786389 2015 Higher expression of HSP70 and LOX-1 in the placental tissues of pre-eclampsia pregnancies.
24742079 2014 Correlation between depression, anxiety, and polymorphonuclear cells' resilience in ulcerative colitis: the mediating role of heat shock protein 70.
24718854 2014 Dual targeting of heat shock proteins 90 and 70 promotes cell death and enhances the anticancer effect of chemotherapeutic agents in bladder cancer.
24715760 2014 ?ypoxia-inducible factor-1?, von Hippel-Lindau protein, and heat shock protein expression in ophthalmic pterygium and normal conjunctiva.
24660549 2014 Transient hypoxia leads to increased serum levels of heat shock protein-27, -70 and caspase-cleaved cytokeratin 18.
24501795 2013 [Analysis of occurrence atypical proteins in the serum at smoking and non-smoking cigarettes patients with lung cancer].
24492285 2014 Correlation of BAG-3 and heat shock protein 70 with CD30 expression in T-cell lymphomas.
24480410 2014 Human heat shock protein 70 (Hsp70) as a peripheral membrane protein.
24474693 2014 Heat shock protein 70 modulates influenza A virus polymerase activity.
24449167 2014 Enteral glutamine infusion modulates ubiquitination of heat shock proteins, Grp-75 and Apg-2, in the human duodenal mucosa.
24425585 2014 T cell recognition of naturally presented epitopes of self-heat shock protein 70.
24376495 2013 IL-10 is significantly involved in HSP70-regulation of experimental subretinal fibrosis.
24355684 2014 Mineralocorticoid receptor and heat shock protein expression levels in peripheral lymphocytes from war trauma-exposed men with and without PTSD.
24354861 2014 Preferential secretion of inducible HSP70 by vitiligo melanocytes under stress.
24347824 2013 Heat shock proteins 60 and 70 specific proinflammatory and cytotoxic response of CD4+CD28null cells in chronic kidney disease.
24327239 2014 The 60- and 70-kDa heat-shock proteins and their correlation with cardiovascular risk factors in postmenopausal women with metabolic syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252366 2013 Proteomic analysis reveals heat shock protein 70 has a key role in polycythemia Vera.
24243066 2014 Association among 1267 A/G HSP70-2, -308 G/A TNF-? polymorphisms and pro-inflammatory plasma mediators in old ZincAge population.
24206096 2014 CAMKII?, HSP70 and HSP90 transcripts are differentially expressed in chronic myeloid leukemia cells from patients with resistant mutated disease.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24095952 2013 Increased expression of heat shock protein 70 in chronic obstructive pulmonary disease.
24086464 2013 Heat shock protein 70 is associated with replicase complex of Japanese encephalitis virus and positively regulates viral genome replication.
24065282 2013 HSP70 and modified HPV 16 E7 fusion gene without the addition of a signal peptide gene sequence as a candidate therapeutic tumor vaccine.
24051131 2013 High levels of heat shock protein 70 are associated with pro-inflammatory cytokines and may differentiate early- from late-onset preeclampsia.
24047968 2013 Novel role of HSP40/DNAJ in the regulation of HIV-1 replication.
24021284 2013 Mutant ?PKC that causes spinocerebellar ataxia type 14 upregulates Hsp70, which protects cells from the mutant's cytotoxicity.
24012426 2013 Hsp70 chaperone dynamics and molecular mechanism.
23990450 2014 Golgi fragmentation induced by heat shock or inhibition of heat shock proteins is mediated by non-muscle myosin IIA via its interaction with glycosyltransferases.
23985798 2013 Single-nucleotide polymorphisms in Toll-like receptor (TLR)-2, TLR4 and heat shock protein 70 genes and susceptibility to scrub typhus.
23973223 2013 The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3.
23965991 2013 Recruitment of a cytoplasmic chaperone relay by the A2A adenosine receptor.
23962724 2014 Prion-like nuclear aggregation of TDP-43 during heat shock is regulated by HSP40/70 chaperones.
23940031 2013 Human mitochondrial chaperone (mtHSP70) and cysteine desulfurase (NFS1) bind preferentially to the disordered conformation, whereas co-chaperone (HSC20) binds to the structured conformation of the iron-sulfur cluster scaffold protein (ISCU).
23913168 2013 Heat shock protein 70 (HSP70) expression is associated with poor prognosis in intestinal type gastric cancer.
23874478 2013 Heat shock protein 70 acts as a potential biomarker for early diagnosis of heart failure.
23840795 2013 Hsp70 oligomerization is mediated by an interaction between the interdomain linker and the substrate-binding domain.
23831374 2013 Mortalin mutations are not a frequent cause of early-onset Parkinson disease.
23807299 2013 Different immunohistochemical levels of Hsp60 and Hsp70 in a subset of brain tumors and putative role of Hsp60 in neuroepithelial tumorigenesis.
23792430 2013 Parthenolide reverses doxorubicin resistance in human lung carcinoma A549 cells by attenuating NF-?B activation and HSP70 up-regulation.
23776617 2013 Towards a more precise serological diagnosis of human tegumentary leishmaniasis using Leishmania recombinant proteins.
23737532 2013 Hsp110 is a bona fide chaperone using ATP to unfold stable misfolded polypeptides and reciprocally collaborate with Hsp70 to solubilize protein aggregates.
23542779 2013 Heavy metal response of the heat shock protein 70 gene is mediated by duplicated heat shock elements and heat shock factor 1.
23528882 2013 Involvement of heat shock protein 70 in the DNA protective effect from estrogen.
23425286 2013 Prognostic significance of heat shock proteins in urothelial carcinoma of the urinary bladder.
23392055 2013 Heat shock protein 70 gene polymorphisms in Japanese patients with aspirin-exacerbated respiratory disease.
23382911 2013 Heat shock protein 70 expression is spatially distributed in human placenta and selectively upregulated during labor and preeclampsia.
23359685 2013 Hsp70/Hsp90 chaperone machinery is involved in the assembly of the purinosome.
23352325 2013 Immunohistochemical expression of heat shock protein 70 in vitiligo.
23276928 2013 Roles of heat-shock protein 70 in protecting against intestinal mucosal damage.
23271055 2013 Imbalance of Hsp70 family variants fosters tau accumulation.
23212539 2013 Circulating anti-Hsp70 levels in nascent metabolic syndrome: the Casale Monferrato Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154057 2013 Interaction between hypertension and HSP70 variants increase the risk of cerebral ischemia in Chinese Han population: an association study.
23152061 2012 CD99 ligation upregulates HSP70 on acute lymphoblastic leukemia cells and concomitantly increases NK cytotoxicity.
23139789 2012 A heat-shock protein axis regulates VEGFR2 proteolysis, blood vessel development and repair.
23109422 2013 Hsp70 is a novel posttranscriptional regulator of gene expression that binds and stabilizes selected mRNAs containing AU-rich elements.
23043959 2013 Positive feedback regulation of heat shock protein 70 (Hsp70) is mediated through Toll-like receptor 4-PI3K/Akt-glycogen synthase kinase-3? pathway.
23023377 2012 Opposing actions of heat shock protein 90 and 70 regulate nicotinamide adenine dinucleotide phosphate oxidase stability and reactive oxygen species production.
22990868 2012 Enhanced HSP70 lysine methylation promotes proliferation of cancer cells through activation of Aurora kinase B.
22901192 2012 Prevalence and pathogenesis of Barrett's esophagus in Luoyang, China.
22689214 2012 Effect of HSP70 and 90 in modulation of JNK, ERK expression in preeclamptic placental endothelial cell.
22613557 2012 Identification of a potential tumor differentiation factor receptor candidate in prostate cancer cells.
22544056 2012 Enhanced J-protein interaction and compromised protein stability of mtHsp70 variants lead to mitochondrial dysfunction in Parkinson's disease.
22535481 2012 High HSP27 and HSP70 expression levels are independent adverse prognostic factors in primary resected colon cancer.
22528773 2012 Titanium dioxide nanoparticles-mediated in vitro cytotoxicity does not induce Hsp70 and Grp78 expression in human bronchial epithelial A549 cells.
22443056 2012 [Protection of HSF1/HSP70 pathway on UVA-induced HaCaT cells apoptosis via inhibiting the activation of c-Jun N-terminal kinase].
22409343 2012 Mechanism of JNK signal regulation by placental HSP70 and HSP90 in endothelial cell during preeclampsia.
22345440 2012 Hsp70 protein positively regulates rabies virus infection.
22343013 2012 DnaJA1 antagonizes constitutive Hsp70-mediated stabilization of tau.
22294379 2012 Changes in lymphocyte HSP70 levels in women handball players throughout 1 year of training: the role of estrogen levels.
22219199 2012 The C-terminal helices of heat shock protein 70 are essential for J-domain binding and ATPase activation.
22157767 2012 Unique peptide substrate binding properties of 110-kDa heat-shock protein (Hsp110) determine its distinct chaperone activity.
22037021 2012 Extracellular HspBP1 inhibits formation of a cytotoxic Tag7-Hsp70 complex in vitro and in human serum.
22032827 2012 HSP27 and HSP70 serum and urine levels in patients suffering from chronic kidney disease.
22022600 2011 The mammalian disaggregase machinery: Hsp110 synergizes with Hsp70 and Hsp40 to catalyze protein disaggregation and reactivation in a cell-free system.
21992180 2011 Heat shock protein 70/peptide complexes: potent mediators for the generation of antiviral T cells particularly with regard to low precursor frequencies.
21972530 2011 [Effects of overexpression of heat shock protein 70 on the damage induced by formaldehyde in vitro].
21940409 2012 Association of heat-shock protein 70 with lipid rafts is required for Japanese encephalitis virus infection in Huh7 cells.
21839816 2011 Pentoxifylline administration changes protein expression profile of coronary artery disease patients.
21775503 2011 Novel mechanism of Hsp70 chaperone-mediated prevention of polyglutamine aggregates in a cellular model of huntington disease.
21763498 2011 Reciprocal regulation of human immunodeficiency virus-1 gene expression and replication by heat shock proteins 40 and 70.
21750953 2012 Down-regulated expression of HSP70 in correlation with clinicopathology of cholangiocarcinoma.
21725599 ShRNA-mediated gene silencing of heat shock protein 70 inhibits human colon cancer growth.
21672353 2011 Heat shock proteins and myocardial protection during cardiopulmonary bypass.
21639839 2011 Kinetics of chaperone activity of proteins Hsp70 and Hdj1 in human leukemia u-937 cells after preconditioning with thermal shock or compound u-133.
21539621 2011 Human keratinocytes release high levels of inducible heat shock protein 70 that enhances peptide uptake.
21522149 2011 Co-overexpression of Bag-1 and heat shock protein 70 in human epidermal squamous cell carcinoma: Bag-1-mediated resistance to 5-fluorouracil-induced apoptosis.
21480956 2011 Expression of heat shock proteins in classical Hodgkin lymphoma: correlation with apoptotic pathways and prognostic significance.
21477782 2011 HSP70 decreases receptor-dependent phosphorylation of Smad2 and blocks TGF-?-induced epithelial-mesenchymal transition.
21442384 2011 Elevated serum levels of heat shock protein 70 can be detected after radiofrequency ablation.
21418859 2011 [Effect of osmotic response element binding protein on mucus secretion with hypertonicity in human airway epithelial cells].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21403392 2011 Association of HSP70 and its co-chaperones with Alzheimer's disease.
21353370 2011 HSP70-mediated control of endothelial cell apoptosis during pre-eclampsia.
21330950 2011 Serum heat shock protein 70 levels, oxidant status, and mortality in sepsis.
21299508 2011 Over expression of HSP70 and HSF1 in endothelial cells during pre-eclamptic placental stress.
21276792 2011 Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21208456 2011 Induction of HSPA4 and HSPA14 by NBS1 overexpression contributes to NBS1-induced in vitro metastatic and transformation activity.
21179807 2002 [TGF-beta and HSP70 expression in human skin fibroblasts after ultraviolet B irradiation].
21161074 2010 Morphofunctional characteristics of syncytiotrophoblast and content of heat shock protein 70 in it during exacerbation of herpesvirus infection in pregnant women.
21046302 2011 Serum level of soluble Hsp70 is associated with vascular calcification.
20964628 2011 Hsp70 binds to PrPC in the process of PrPC release via exosomes from THP-1 monocytes.
20876215 2011 Heat-shock protein 70 modulates toxic extracellular ?-synuclein oligomers and rescues trans-synaptic toxicity.
20842208 2010 Tolerating diabetes: an alternative therapeutic approach for diabetic neuropathy.
20809635 2010 Peptide-binding sites as revealed by the crystal structures of the human Hsp40 Hdj1 C-terminal domain in complex with the octapeptide from human Hsp70.
20806409 2010 Aberrant stress-induced Hsp70 expression in immune cells in multiple sclerosis.
20735358 2010 The chaperone proteins HSP70, HSP40/DnaJ and GRP78/BiP suppress misfolding and formation of ?-sheet-containing aggregates by human amylin: a potential role for defective chaperone biology in Type 2 diabetes.
20731692 2010 Standardized tape stripping prior to patch testing induces upregulation of Hsp90, Hsp70, IL-33, TNF-? and IL-8/CXCL8 mRNA: new insights into the involvement of 'alarmins'.
20714862 2010 Expression of Hsp27 and Hsp70 in lymphocytes and plasma in healthy workers and coal miners with lung cancer.
20714140 2011 Association of polymorphisms of heat shock protein 70 with susceptibility to noise-induced hearing loss in the Taiwanese population.
20632817 2010 Expression of heat shock proteins in osteosarcomas.
20583115 2011 Expression of p53, MDM2, p21, heat shock protein 70, and HPV 16/18 E6 proteins in oral verrucous carcinoma and oral verrucous hyperplasia.
20569278 2010 The endogenous danger signals HSP70 and MICA cooperate in the activation of cytotoxic effector functions of NK cells.
20568452 2010 [Effect of HSP70 gene polymorphism on genetic susceptibility of pneumoconiosis of coal worker].
20498198 2010 Polymorphisms in the Hsp70 gene locus are genetically associated with systemic lupus erythematosus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20426530 2010 Reduced heat shock protein 70 in airway smooth muscle in patients with chronic obstructive pulmonary disease.
20354811 2010 Multifaceted role of heat shock protein 70 in neurons.
20353025 2010 [Relationship between Pi-Wei damp-heat syndrome with expressions of nuclear factor-kappaB mRNA and heat shock protein 70 mRNA in patients with chronic gastritis].
20300983 2010 Plasma levels of Hsp70 and anti-Hsp70 antibody predict risk of acute coronary syndrome.
20170613 2010 [The significance of the changes in expressions of heat shock protein 70 and heme oxygenase-1 in the myocardium in patients died suddenly due to acute myocardial infarction].
20132183 2010 Sub-lethal heat shock induces plasma membrane translocation of 70-kDa heat shock protein in viable, but not in apoptotic, U-937 leukaemia cells.
20069064 2010 Association of eNOS and HSP70 gene polymorphisms with glaucoma in Pakistani cohorts.
20026329 2010 Gentamicin inhibits HSP70-assisted protein folding by interfering with substrate recognition.
19952398 2009 [Expression of HSP70/HSP27 protein in residual lesion after NPC radiotherapy].
19919883 2010 Cerebrospinal fluids containing anti-HSP70 autoantibodies from multiple sclerosis patients augment HSP70-induced proinflammatory cytokine production in monocytic cells.
19802386 2009 COMMD1 Promotes pVHL and O2-Independent Proteolysis of HIF-1alpha via HSP90/70.
19766166 2009 TAAR 6 and HSP-70 variations associated with bipolar disorder.
19764559 2009 [In vitro study of expression and effects of HSP70/HSP90 in nasopharyngeal carcinoma cells after thermotherapy].
19758266 Patient HSP70-hom TG haplotype is associated with decreased transplant-related mortality and improved survival after sibling HLA-matched hematopoietic stem cell transplantation.
19758187 2009 A dual role for HSP90 and HSP70 in the inflammatory myopathies: from muscle fiber protection to active invasion by macrophages.
19716411 2010 Life stress, negative mood states, and antibodies to heat shock protein 70 in endometrial cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19635199 2009 [Expressions of heat shock protein (HSP) family HSP 60, 70 and 90alpha in colorectal cancer tissues and their correlations to pathohistological characteristics].
19620938 2009 Expression and clinical role of antiapoptotic proteins of the bag, heat shock, and Bcl-2 families in effusions, primary tumors, and solid metastases in ovarian carcinoma.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19604401 2009 Heat shock protein 70-mediated sensitization of cells to apoptosis by Carboxyl-Terminal Modulator Protein.
19598015 2009 [Association between expressions of HSP70, HSP90 and efficacy of chemotherapy in colorectal cancer patients with unresectable liver metastasis].
19544471 2009 Evaluating erythropoietin-associated tumor progression using archival tissues from a phase III clinical trial.
19543852 2009 Proteomic analysis reveals significant elevation of heat shock protein 70 in patients with chronic heart failure due to arrhythmogenic right ventricular cardiomyopathy.
19529862 2009 Short-term highly intense physiological stress causes an increase in the expression of heat shock protein in human leukocytes.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19475432 2009 Heat shock proteins in children and young adults on chronic hemodialysis.
19420297 2009 Expression of hsp22 and hsp70 transgenes is partially predictive of drosophila survival under normal and stress conditions.
19231003 2009 The application of markers (HSP70 GPC3 and GS) in liver biopsies is useful for detection of hepatocellular carcinoma.
19205928 2009 Circulating anti-heat-shock-protein antibodies in normal pregnancy and preeclampsia.
19116451 2008 CD36 signaling inhibits the translation of heat shock protein 70 induced by oxidized low density lipoprotein through activation of peroxisome proliferators-activated receptor gamma.
19069644 2008 [Synergistic effect of thermotherapy in combination with chemotherapy on lung tumor A549 cells growth through activation of c-Jun N-terminal kinase and inhibition of heat shock protein70 expression].
19026123 Serum levels of free heat shock protein 70 and anti-HSP70 are elevated in Behçet's disease.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19017364 Synergistic promotion of breast cancer cells death by targeting molecular chaperone GRP78 and heat shock protein 70.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18813348 2008 Hsf1 is required for the nuclear translocation of p53 tumor suppressor.
18799101 Serum levels of heat shock protein 70, a biomarker of cellular stress, are elevated in patients with systemic sclerosis: association with fibrosis and vascular damage.
18790094 2008 cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins.
18686014 2009 Increased serum heat-shock protein 70 levels reflect systemic inflammation, oxidative stress and hepatocellular injury in preeclampsia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18651163 2008 Effects of ultra-marathon on circulating DNA and mRNA expression of pro- and anti-apoptotic genes in mononuclear cells.
18608178 2009 Cell surface and relative mRNA expression of heat shock protein 70 in human synovial cells.
18587674 2008 HBP21: a novel member of TPR motif family, as a potential chaperone of heat shock protein 70 in proliferative vitreoretinopathy (PVR) and breast cancer.
18550409 2008 Structure of the Hsp110:Hsc70 nucleotide exchange machine.
18505677 2008 Hsp70 associates with Rictor and is required for mTORC2 formation and activity.
18489731 2008 Aging-related differences in basal heat shock protein 70 levels in lymphocytes are linked to altered frequencies of lymphocyte subsets.
18456818 2008 Human recombinant heat shock protein 70 affects the maturation pathways of dendritic cells in vitro and has an in vivo adjuvant activity.
18439902 2008 PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1.
18426646 2008 [Expression characteristics of heat shock protein 70 and pim-1 gene in bone marrow mononuclear cells from leukemia patients and their clinical significance].
18418731 2008 Heat shock proteins HSP70 and HSP27 in the cerebral spinal fluid of patients undergoing thoracic aneurysm repair correlate with the probability of postoperative paralysis.
18322243 2008 Hsp70 translocates into the plasma membrane after stress and is released into the extracellular environment in a membrane-associated form that activates macrophages.
18297536 2008 Analysis of cell surface and relative gene expression of heat shock protein 70 in human leukemia cell lines.
18258197 2008 TAT-Hsp40 inhibits oxidative stress-mediated cytotoxicity via the inhibition of Hsp70 ubiquitination.
18162458 Effect of a topical treatment in organotypic culture of human breast skin after exposure to gamma-rays.
18088459 2007 [Expression of HSP70 mRNA and MDR1 mRNA in K562 cells induced by heat shock and ADM].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17988935 2008 Association between heat-shock protein 70 gene polymorphisms and DNA damage in peripheral blood lymphocytes among coke-oven workers.
17802821 2007 [Expression and significance of TGF-beta1 and HSP70 in human laryngeal squamous cell carcinoma].
17616937 2007 Expression of heat shock protein 70 in renal cell carcinoma and its relation to tumor progression and prognosis.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17580361 2007 Patient survival by Hsp70 membrane phenotype: association with different routes of metastasis.
17553457 2007 Diverse regulatory activity of human heat shock proteins 60 and 70 on endotoxin-induced inflammation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17311516 2007 Heat shock protein 70-1 gene expression in pediatric heart surgery using blood cardioplegia.
17278883 2006 TRAIL-induced apoptosis is enhanced by heat shock protein 70 expression.
17278882 2006 Heat shock protein 70 and glycoprotein 96 are differentially expressed on the surface of malignant and nonmalignant breast cells.
17240362 2007 Accumulation of Hsc70 and Hsp70 in glial cytoplasmic inclusions in patients with multiple system atrophy.
17211576 2007 Basal and infection-induced levels of heat shock proteins in human aging.
17206383 2007 Plasminogen and angiostatin interact with heat shock proteins.
17027895 2007 Virion tails of Beet yellows virus: Coordinated assembly by three structural proteins.
17012257 2006 Detection of novel intracellular alpha-synuclein oligomeric species by fluorescence lifetime imaging.
17010992 2006 Heat shock protein 70 inhibits alpha-synuclein fibril formation via interactions with diverse intermediates.
16845230 2006 Helicobacter pylori inhibits expression of heat shock protein 70 (HSP70) in human epithelial cell line. Importance of Cag A protein.
16790501 2006 Human esophageal microvascular endothelial cells respond to acidic pH stress by PI3K/AKT and p38 MAPK-regulated induction of Hsp70 and Hsp27.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16598923 2006 [Effect of heat and BPDE on the expression of Hsp27 and Hsp70 in A549 cell line].
16584808 2006 The release of Hsp70 from A431 carcinoma cells is mediated by secretory-like granules.
16579839 2006 The mechanism of heat-shock protein 70 gene expression abolition in gastric epithelium caused by Helicobacter pylori infection.
16248461 2005 [Study on the expression of HSP70 and HSP90beta in nasopharyngeal carcinoma and the clinical significance].
16021519 2005 A two-dimensional electrophoresis reference map of human ovary.
15992611 2005 1267 HSP70-2 polymorphism as a risk factor for carotid plaque rupture and cerebral ischaemia in old type 2 diabetes-atherosclerotic patients.
15950770 2005 Geldanamycin activates Hsp70 response and attenuates okadaic acid-induced cytotoxicity in human retinal pigment epithelial cells.
15818324 2005 HSP70-hom gene polymorphism in allogeneic hematopoietic stem-cell transplant recipients correlates with the development of acute graft-versus-host disease.
15677475 2005 Preheating accelerates mitogen-activated protein (MAP) kinase inactivation post-heat shock via a heat shock protein 70-mediated increase in phosphorylated MAP kinase phosphatase-1.
15644312 2005 Dissection of the mitochondrial import and assembly pathway for human Tom40.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15529360 2004 Inhibition of adjuvant-induced arthritis by DNA vaccination with the 70-kd or the 90-kd human heat-shock protein: immune cross-regulation with the 60-kd heat-shock protein.
15507967 2004 Polymorphisms in the tumor necrosis factor-alpha gene at position -308 and the inducible 70 kd heat shock protein gene at position +1267 in multifetal pregnancies and preterm premature rupture of fetal membranes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378924 Content and synthesis of stress proteins in subcellular structures of cancer cells exposed to heat shock and cisplatin.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14987991 2004 Apg-2 has a chaperone-like activity similar to Hsp110 and is overexpressed in hepatocellular carcinomas.
12754272 2003 The chaperone environment at the cytoplasmic face of the endoplasmic reticulum can modulate rhodopsin processing and inclusion formation.
12526792 2003 Molecular chaperones Hsp90 and Hsp70 deliver preproteins to the mitochondrial import receptor Tom70.
12485826 2002 Inducible hsp70 expression analysis after heat and physical exercise: transcriptional, protein expression, and subcellular localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356871 2002 CD40, an extracellular receptor for binding and uptake of Hsp70-peptide complexes.
11932435 2002 Specific incorporation of heat shock protein 70 family members into primate lentiviral virions.
11777905 2002 Human class I histone deacetylase complexes show enhanced catalytic activity in the presence of ATP and co-immunoprecipitate with the ATP-dependent chaperone protein Hsp70.
11707406 2001 Proteomic and functional evidence for a P2X7 receptor signalling complex.
10964507 2000 Heat-shock protein 70 can replace viral protein R of HIV-1 during nuclear import of the viral preintegration complex.
10617616 2000 Requirement for a kinase-specific chaperone pathway in the production of a Cdk9/cyclin T1 heterodimer responsible for P-TEFb-mediated tat stimulation of HIV-1 transcription.
10524232 1999 Cloning of human cDNAs for Apg-1 and Apg-2, members of the Hsp110 family, and chromosomal assignment of their genes.
9694873 1998 Evidence for the existence of distinct mammalian cytosolic, microsomal, and two mitochondrial GrpE-like proteins, the Co-chaperones of specific Hsp70 members.
9392437 1997 The unliganded mineralocorticoid receptor is associated with heat shock proteins 70 and 90 and the immunophilin FKBP-52.
9161406 1997 Cloning of apg-2 encoding a novel member of heat shock protein 110 family.
9115634 1997 Identification and characterization of a novel hsc70-like gene in the human lung tumor cell line HS24.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8335910 1993 Molecular cloning of a novel human hsp70 from a B cell line and its assignment to chromosome 5.