Property Summary

NCBI Gene PubMed Count 17
PubMed Score 38.42
PubTator Score 9.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.544 1.6e-03
intraductal papillary-mucinous carcinoma... 1.100 4.5e-03
lung cancer 1.400 2.8e-02
invasive ductal carcinoma 1.500 7.0e-03
spina bifida -1.141 4.6e-02
ovarian cancer 2.000 5.2e-05
dermatomyositis 1.100 2.0e-03

Synonym

Accession Q0VDF9 A8K8F8 B0YIY9 Q9P0X2 Q9UI07
Symbols HSP70-4
HSP70L1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (13)

PMID Text
21738476 Hsp70 co-sediments with HIV-1 capsid protein in sucrose density gradients, providing evidence that it is specifically incorporated into HIV-1 virions through an interaction with HIV-1 Gag proteins
21730052 TLR4 is a key receptor mediating the interaction of Hsp70L1 with DCs and subsequently enhancing the induction of Th1 immune response by Hsp70L1/antigen fusion protein
21208456 a novel pathway (NBS1-HSF4b-HSPA4/HSPA14 axis) to induce migration, invasion, and transformation, suggesting the activation of multiple signaling events induced by NBS1 overexpression
20689807 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of heat shock 70kDa protein 14 (HSPA14) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
14592822 results demonstrate that Hsp70L1 has enhanced Th1 polarizing and adjuvant properties, which appear to be mediated via activation of dendritic cells
12832005 Hsp70 co-sediments with HIV-1 capsid protein in sucrose density gradients, providing evidence that it is specifically incorporated into HIV-1 virions through an interaction with HIV-1 Gag proteins
11932435 Hsp70 co-sediments with HIV-1 capsid protein in sucrose density gradients, providing evidence that it is specifically incorporated into HIV-1 virions through an interaction with HIV-1 Gag proteins
7906708 Hsp70 co-sediments with HIV-1 capsid protein in sucrose density gradients, providing evidence that it is specifically incorporated into HIV-1 virions through an interaction with HIV-1 Gag proteins

AA Sequence

MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQI      1 - 70
LGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVV     71 - 140
ITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEV    141 - 210
NSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANC    211 - 280
FLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKD    281 - 350
LFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT    351 - 420
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHV    421 - 490
TCTDQETGKCEAISIEIAS                                                       491 - 509
//

Text Mined References (27)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21730052 2011 Toll-like receptor 4 (TLR4) is essential for Hsp70-like protein 1 (HSP70L1) to activate dendritic cells and induce Th1 response.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21208456 2011 Induction of HSPA4 and HSPA14 by NBS1 overexpression contributes to NBS1-induced in vitro metastatic and transformation activity.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18851947 2008 Protective effect of a RSV subunit vaccine candidate G1F/M2 was enhanced by a HSP70-Like protein in mice.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16002468 2005 The chaperones MPP11 and Hsp70L1 form the mammalian ribosome-associated complex.
15930317 2005 Hsp70-like protein 1 fusion protein enhances induction of carcinoembryonic antigen-specific CD8+ CTL response by dendritic cell vaccine.
15802566 2005 Human Mpp11 J protein: ribosome-tethered molecular chaperones are ubiquitous.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592822 2004 Novel heat shock protein Hsp70L1 activates dendritic cells and acts as a Th1 polarizing adjuvant.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10786835 2000 Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.