Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.87
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -3.000 4.9e-07
aldosterone-producing adenoma -1.777 7.9e-03
astrocytic glioma -2.400 1.2e-03
atypical teratoid / rhabdoid tumor -4.100 5.1e-10
cystic fibrosis 1.040 1.4e-04
ductal carcinoma in situ -2.400 1.0e-03
ependymoma -2.600 4.7e-03
fibroadenoma -1.700 4.9e-02
glioblastoma -2.700 2.7e-09
group 3 medulloblastoma -3.100 1.2e-04
invasive ductal carcinoma -2.500 1.2e-02
medulloblastoma, large-cell -2.800 1.4e-03
oligodendroglioma -1.600 2.0e-02
ovarian cancer -2.900 2.0e-12
Pick disease -1.400 8.2e-03
primitive neuroectodermal tumor -2.100 3.9e-03
psoriasis -1.100 2.5e-08

 GO Function (1)

 GO Component (1)

Gene RIF (5)

AA Sequence

MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAVDFGTTSSGY      1 - 70
AYSFTKEPECIHVMRRWEGGDPGVSNQKTPTTILLTPERKFHSFGYAARDFYHDLDPNEAKQWLYLEKFK     71 - 140
MKLHTTGDLTMDTDLTAANGKKVKALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQP    141 - 210
AKQFMRQAAYQAGLASPENSEQLIIALEPEAASIYCRKLRLHQMIELSSKAAVNGYSGSDTVGAGFTQAK    211 - 280
EHIRRNRQSRTFLVENVIGEIWSELEEGDKYVVVDSGGGTVDLTVHQIRLPEGHLKELYKATGGPYGSLG    281 - 350
VDYEFEKLLYKIFGEDFIEQFKIKRPAAWVDLMIAFESRKRAAAPDRTNPLNITLPFSFIDYYKKFRGHS    351 - 420
VEHALRKSNVDFVKWSSQGMLRMSPDAMNALFKPTIDSIIEHLRDLFQKPEVSTVKFLFLVGGFAEAPLL    421 - 490
QQAVQAAFGDQCRIIIPQDVGLTILKGAVLFGLDPAVIKVRRSPLTYGVGVLNRYVEGKHPPEKLLVKDG    491 - 560
TRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTG    561 - 630
TSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGIDFLNY                             631 - 675
//

Text Mined References (20)

PMID Year Title