Property Summary

NCBI Gene PubMed Count 162
PubMed Score 629.16
PubTator Score 378.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.114 1.0e-04
Amyotrophic lateral sclerosis 1.014 7.0e-06
atypical teratoid / rhabdoid tumor 1.100 2.4e-04
autosomal dominant Emery-Dreifuss muscul... 1.376 8.6e-04
Barrett's esophagus 1.100 4.7e-02
Down syndrome 1.500 3.7e-03
Duchenne muscular dystrophy 1.193 1.2e-07
ependymoma 1.300 3.1e-02
esophageal adenocarcinoma 1.600 1.8e-02
glioblastoma 1.900 2.0e-02
juvenile dermatomyositis 1.161 1.7e-09
lung adenocarcinoma 2.539 4.3e-10
medulloblastoma, large-cell 1.200 1.6e-04
Multiple Sclerosis 1.100 1.8e-02
non-small cell lung cancer 1.228 2.0e-11
oligodendroglioma 1.100 1.0e-02
osteosarcoma 1.443 1.4e-03
ovarian cancer 3.900 1.3e-08
Parkinson's disease -1.200 2.8e-02
pediatric high grade glioma 1.300 2.0e-04
progressive supranuclear palsy -1.200 1.8e-02
psoriasis 1.200 1.9e-05
Rheumatoid arthritis 1.100 3.0e-02
ulcerative colitis 1.500 7.0e-08

Gene RIF (113)

AA Sequence

MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELR      1 - 70
EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDK     71 - 140
EKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVI    141 - 210
VTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIY    211 - 280
VWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEV    281 - 350
EEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD    351 - 420
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGT    421 - 490
NIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLK    491 - 560
KGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDK    561 - 630
IEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRR    631 - 700
IKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDT    701 - 770
TEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL                                         771 - 803
//

Text Mined References (172)

PMID Year Title