Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MSLIINTFYSNKEIFLQELISNASDALDKIRYESLTDPSKLDGGKELKIDIIPNPRECILTLVNTGIGMT      1 - 70
KADLINNLGAIAKSGTEAFMEAFQSCAEISMIGQFGVGFYSAYLVAEKVAITKHNDEEQYSWVSSAGSSF     71 - 140
TLHVDHGEPIDRDTKVILHLKEDQTEYLEERWVKEVVKKHPQFIGCLIAVYLEKEPEKEISDDEEEKGEK    141 - 210
EEEDKDDKEKPKTEDVGSDEEDDTDKNNKKKTKKIKEKYTDREELNQTKPIWTRNPDDITQEECGEFYKS    211 - 280
LTSAWEDHLAVKQFPVEEQEENEQLCVHHVWIMDSFDDLMPEYVGFVREDKENNKKLDEVFSKISWLGIH    281 - 350
EDSINWRHLSELLWSHTFQSGDEMTSLSEYVSCMKEAQKSICDIIGECKEQVANSAFVEQEWKKGFEVIY    351 - 420
MSEPIDEYCVQQLKEFDGKSLLSVTKEGLELPEDEEEKKIMEESNVKFENLCRLMKEILDKKVERVTISS    421 - 490
RLVSSPCRIVTSTYS                                                           491 - 505
//

Text Mined References (3)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.