Property Summary

NCBI Gene PubMed Count 6
PubMed Score 162.44

Knowledge Summary


No data available


  Disease (1)

 GO Function (1)

Gene RIF (1)

16507910 These data implicate predominantly Hsp90 in the formation of alpha-synuclein inclusions in Parkinson's disease and related alpha-synucleinopathies

AA Sequence

VTVSNRLVSSSCCIVTSTYSWTANMEQIMKA                                           351 - 381

Text Mined References (7)

PMID Year Title
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16507910 2006 Convergence of heat shock protein 90 with ubiquitin in filamentous alpha-synuclein inclusions of alpha-synucleinopathies.
16288044 2005 Activated tyrosine kinase Ack1 promotes prostate tumorigenesis: role of Ack1 in polyubiquitination of tumor suppressor Wwox.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.