Property Summary

NCBI Gene PubMed Count 137
PubMed Score 162.44
PubTator Score 152.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer -1.800 2.1e-03
pancreatic cancer -2.000 1.1e-03
interstitial lung disease -1.300 3.3e-02
Waldenstrons macroglobulinemia 1.147 2.7e-02
Multiple myeloma 2.327 3.9e-05
ependymoma 1.200 1.5e-02
oligodendroglioma 1.700 2.0e-03
osteosarcoma 2.430 3.4e-05
medulloblastoma, large-cell 1.300 4.1e-02
acute quadriplegic myopathy 1.040 3.1e-05
non-small cell lung cancer 1.528 1.8e-06
intraductal papillary-mucinous neoplasm ... -1.600 2.9e-02
lung cancer 1.400 3.0e-04
Breast cancer 2.600 2.5e-02
interstitial cystitis -1.200 1.4e-03
adult high grade glioma -1.900 1.4e-02
pancreatic carcinoma -2.000 1.1e-03
subependymal giant cell astrocytoma -3.502 2.8e-02
invasive ductal carcinoma -1.179 3.5e-03
lung adenocarcinoma 1.878 1.1e-09
ovarian cancer -2.500 1.2e-04

Gene RIF (61)

PMID Text
26651243 We revealed that Hsp90A and Hsp90B are partly colocalized with heparan sulfate proteoglycans (HSPGs) on the cell surface and that this colocalization was sensitive to heparin.
26511315 Apart from these distinct Cdc37/Hsp90 interfaces, binding of the B-Raf protein kinase to the cochaperone is conserved between mammals and nematodes.
26358502 HSP90AB1: Helping the good and the bad
26134567 These results suggest a means by which the hsp90beta interaction could prevent apo-sGCbeta1 from associating with its partner sGCalpha1 subunit while enabling structural changes to assist heme insertion into the H-NOX domain.
26044951 This study identifies overexpression of HSP90 (especially isoform HSP90AB1) and its clients ATR, ATM, and NBS1 as promising markers for radioresistant, aggressive soft tissue sarcomas with particularly poor prognosis.
25995454 Casein kinase 2-mediated phosphorylation of Hsp90beta and stabilization of PXR is a key mechanism in the regulation of MDR1 expression.
25486457 These results suggest that differences in the middle domain of Hsp90alpha and Hsp90beta may be responsible for the isoform-specific interactions with selected proteins.
25300907 The expression levels of Hsp90-beta and annexin A1 positively correlated and such co-overexpression of Hsp90-beta and annexin A1 contributed to lung cancer diagnosis.
25191796 The proteins (HSP90b, TMS1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases.
24880080 A novel mechanism for human carcinogenesis via methylation of HSP90AB1 by SMYD2.
24670792 HSP70 was massively up-regulated in all mast cells three months after irradiation whereas HSP90AB1 was up-regulated only in a portion of mast cells
24581495 Study obtained a structural model of Hsp90 in complex with its natural disease-associated substrate, the intrinsically disordered Tau protein. Hsp90 binds to a broad region in Tau that includes the aggregation-prone repeats.
24511009 The frequency of mutant CC genotype for HSP90AA1 (rs4947C/T), mutant AA genotype for HSP90AB1 (rs13296A/G) and mutant CC genotype for HSP90B1 (rs2070908 C/G) was significantly higher in the patient group than in controls.
24466266 Hsp90 binds directly to fibronectin (FN) and inhibition reduces the extracellular fibronectin matrix in breast cancer cells.
24292678 CDC37 has an important role in chaperoning protein kinases; it stabilizes kinase clients by a mechanism that is not dependent on a substantial direct interaction between CDC37 and HSP90, but requires HSP90 activity
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock protein 90kDa, class B member 1 (HSP90AB1) expression by HIV-1 Vpr in Vpr transduced macrophages
23711381 Here we describe the specific association of heat shock protein-90-beta (Hsp90beta) with EV71 viral particles by the co-purification with virions using sucrose density gradient ultracentrifugation and colocalization as shown by immunogold EM.
23661493 Hsp90 is upregulated in systemic sclerosis (SSc) and is critical for TGF-beta signalling.
23516526 differences in expression caused by the -144 polymorphism in the HSP90beta promoter are associated with cellular inflammatory responses and the severity of organ injury
23515950 HSP90beta may positively regulate angiogenesis, not only as a protein chaperone, but also as an mRNA stabilizer for pro-angiogenic genes, such as BAZF, in a PRKD2 activity-dependent manner.
23287597 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock protein 90kDa, class B member 1 (HSP90AB1) expression by HIV-1 Vpr in Vpr transduced macrophages
23200770 the transdominant effect of HSP90AB1 on capsid-spacer protein 1-mutant HIV infectivity suggests a potential role for this class of cellular chaperones in HIV core stability and uncoating.
23200770 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock protein 90kDa, class B member 1 (HSP90AB1) expression by HIV-1 Vpr in Vpr transduced macrophages
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock protein 90kDa, class B member 1 (HSP90AB1) expression by HIV-1 Vpr in Vpr transduced macrophages
22944692 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock protein 90kDa, class B member 1 (HSP90AB1) expression by HIV-1 Vpr in Vpr transduced macrophages
22929401 The upregulation of Hsp90-beta was associated with poor post-surgical survival time and lymphatic metastasis of lung cancer patients
22849407 results demonstrate that Hsp90 plays an essential role in regulating PTK6 stability and suggest that Hsp90 inhibitors may be useful as therapeutic drugs for PTK6-positive cancers, including breast cancer
22848402 Using a proteomic analysis, we determined that the cleavage occurs in a conserved motif of the N-terminal nucleotide binding site, between Ile-126 and Gly-127 in Hsp90beta, and between Ile-131 and Gly-132 in Hsp90alpha.
22185817 DNA sequencing of 101 human samples detects eight and seven unique single nucleotide polymorphisms (SNPs) at the HSP90AA1 and HSP90AB1 loci, respectively.
22019372 Data identify HSP90 as a pro-inflammatory molecule in retinal pigmented epithelial cell sterile inflammatory responses.
21738476 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock protein 90kDa, class B member 1 (HSP90AB1) expression by HIV-1 Vpr in Vpr transduced macrophages
21689689 TRIM8 modulates translocation of phosphorylated STAT3 into the nucleus through interaction with Hsp90beta and consequently regulates transcription of Nanog in embryonic stem cells.
21602280 a possible role for HSP90AB1 in postentry HIV replication and may provide an attractive target for therapeutic intervention.
20946244 cyclophilin A and Hsp90 facilitate translocation of lethal factor(N) diphtheria toxin, but not of lethal factor, across endosomal membranes, and thus they function selectively in promoting translocation of certain proteins, but not of others
20705598 Results show that RPL4, RPLP0, and HSPCB were the most stable reference genes in ovarian tissues.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20451655 H. pylori induces the translocation of HSP90beta from the cytosol to the membrane and interaction of HSP90beta and Rac1, which leads to the activation of NADPH oxidase and production of ROS in gastric epithelial cells.
20226818 findings present novel Hsp90 mutants that render cells resistant to Hsp90 inhibitors; show that the resistance depends on the increased ATPase turnover due to enhanced interaction with Aha1
19996313 Data show that the small molecule celastrol inhibits the Hsp90 chaperoning machinery by inactivating the co-chaperone p23, resulting in a more selective destabilization of steroid receptors.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19858214 celastrol may represent a new class of Hsp90 inhibitor by modifying Hsp90 C terminus to allosterically regulate its chaperone activity and disrupt Hsp90-Cdc37 complex.
19802386 COMMD1 has a role in conjunction with HSP90beta/HSP70 in the ubiquitin and O(2)-independent regulation of HIF-1alpha
19773279 Observational study of gene-disease association. (HuGE Navigator)
19576239 Expression profiling of Hsp90alpha and Hsp90beta and its cochaperone proteins may be useful for cancer diagnosis and prognosis.
19380486 Results show that heat shock protein 90 beta is cleaved by activated caspase-10 under UVB irradiation.
19327008 Study points to a potential role for Hsp90beta in MSC biology.
19254810 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19047110 Hsp90 overexpression correlates with several adverse parameters for gastrointestinal stromal tumors. Hsp90alpha seems more relevant to the aggressiveness of gastrointestinal stromal tumors than Hsp90beta
19022436 Presence of ovarian autoantibodies to human HSP90 in sera of women with infertility could be involved in human ovarian autoimmunity and thereby be a causative factor in early ovarian failure.
18591256 These data provide an explanation for apoptosome inhibition by activated leukemogenic tyrosine kinases and suggest that alterations in Hsp90beta-apoptosome interactions may contribute to chemoresistance in leukemias.
18412542 Tah1 is specific for Hsp90, and is able to bind tightly the yeast Hsp90, and the human Hsp90alpha and Hsp90beta proteins, but not the yeast Hsp70 Ssa1 isoform
18400751 conformational analysis of hydrolysis by human Hsp90alpha and Hsp90beta
18347946 The conversion of Thr(566) and Ala(629) of Hsp90alpha to Ala(558) and Met(621) is primarily responsible for impeded dimerization of Hsp90beta.
18285346 GCUNC45 is required for the normal cellular distribution of Hsp90beta, but not Hsp90alpha.
18239673 Results suggest that HSP90 beta prevents auto-ubiquitination and degradation of its client protein c-IAP1, whose depletion would be sufficient to inhibit cell differentiation.
17764690 Hydrogen-exchange mass spectrometry was used to study structural & conformational changes undergone by full-length Hsp90beta in solution upon binding of the co-chaperone Cdc37 & 2 Hsp90 ATPase inhibitors: Radicicol & the anticancer drug DMAG
16280321 JAK1/2 are client proteins of Hsp90 alpha and beta; Hsp90 and CDC37 play a critical role in types I and II interferon pathways
16248461 The overexpression of HSP70 and HSP90beta are probably correlated with the occurrence, development and prognosis of nasopharyngeal carcinoma.
15581363 Mutations at the phosphorylation sites of HSP90-beta modulate the interaction with arylhydrocarbon receptor (AhR) and may negatively regulate formation of the functional AhR complex in the steady-state cytosol.
15284248 hsp90beta is repressed by p53 in UV irradiation-induced apoptosis
14532285 PKC-epsilon is specifically required in the signaling pathway leading to the induction of hsp90 beta gene in response to heat shock.

AA Sequence

MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKE      1 - 70
LKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVA     71 - 140
EKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIG    141 - 210
YPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQE    211 - 280
ELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK    281 - 350
NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA    351 - 420
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGES    421 - 490
KEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKF    491 - 560
ENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINP    561 - 630
DHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEP    631 - 700
NAAVPDEIPPLEGDEDASRMEEVD                                                  701 - 724
//

Text Mined References (160)

PMID Year Title
26651243 2015 Cell surface heparan sulfate proteoglycans are involved in the binding of Hsp90? and Hsp90? to the cell plasma membrane.
26593036 2015 The activity of protein phosphatase 5 towards native clients is modulated by the middle- and C-terminal domains of Hsp90.
26511315 2015 Hsp90·Cdc37 Complexes with Protein Kinases Form Cooperatively with Multiple Distinct Interaction Sites.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26358502 2016 HSP90AB1: Helping the good and the bad.
26134567 2015 Heat Shock Protein 90 Associates with the Per-Arnt-Sim Domain of Heme-free Soluble Guanylate Cyclase: IMplications for Enzyme Maturation.
26044951 2015 HSP90 inhibition as a means of radiosensitizing resistant, aggressive soft tissue sarcomas.
25995454 2015 Casein Kinase 2 (CK2)-mediated Phosphorylation of Hsp90? as a Novel Mechanism of Rifampin-induced MDR1 Expression.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25486457 2015 Middle domain of human Hsp90 isoforms differentially binds Aha1 in human cells and alters Hsp90 activity in yeast.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25300907 2014 Co-overexpression of Hsp90-? and annexin A1 with a significantly positive correlation contributes to the diagnosis of lung cancer.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25191796 2014 Potential diagnostic significance of HSP90, ACS/TMS1, and L-plastin in the identification of melanoma.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24880080 2014 SMYD2-dependent HSP90 methylation promotes cancer cell proliferation by regulating the chaperone complex formation.
24681825 2014 The NLR-related protein NWD1 is associated with prostate cancer and modulates androgen receptor signaling.
24670792 2014 Down-regulation of heat shock protein HSP90ab1 in radiation-damaged lung cells other than mast cells.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24618592 2014 Hepatitis B virus polymerase suppresses NF-?B signaling by inhibiting the activity of IKKs via interaction with Hsp90?.
24613385 2014 Hsp70 and Hsp90 oppositely regulate TGF-? signaling through CHIP/Stub1.
24581495 2014 Hsp90-Tau complex reveals molecular basis for specificity in chaperone action.
24511009 2014 The significance of HSP90AA1, HSP90AB1 and HSP90B1 gene polymorphisms in a Turkish population with non-small cell lung cancer.
24466266 2014 Hsp90 binds directly to fibronectin (FN) and inhibition reduces the extracellular fibronectin matrix in breast cancer cells.
24292678 2015 Restricting direct interaction of CDC37 with HSP90 does not compromise chaperoning of client proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24098578 2013 Heat shock protein 90: role in enterovirus 71 entry and assembly and potential target for therapy.
23711381 2013 Heat shock protein-90-beta facilitates enterovirus 71 viral particles assembly.
23661493 2014 Heat shock protein 90 (Hsp90) inhibition targets canonical TGF-? signalling to prevent fibrosis.
23585225 2013 LPS induces pp60c-src-mediated tyrosine phosphorylation of Hsp90 in lung vascular endothelial cells and mouse lung.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23516526 2013 The -144C/A polymorphism in the promoter of HSP90beta is associated with multiple organ dysfunction scores.
23515950 2013 Protein kinase D2 and heat shock protein 90 beta are required for BCL6-associated zinc finger protein mRNA stabilization induced by vascular endothelial growth factor-A.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23431407 2013 Distinct roles of molecular chaperones HSP90? and HSP90? in the biogenesis of KCNQ4 channels.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23200770 2013 Heat shock protein 90AB1 and hyperthermia rescue infectivity of HIV with defective cores.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22929401 2012 Upregulation of Hsp90-beta and annexin A1 correlates with poor survival and lymphatic metastasis in lung cancer patients.
22849407 2012 Hsp90 rescues PTK6 from proteasomal degradation in breast cancer cells.
22848402 2012 Hsp90 is cleaved by reactive oxygen species at a highly conserved N-terminal amino acid motif.
22828320 2012 Investigation on PLK2 and PLK3 substrate recognition.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22185817 2012 An evaluation of single nucleotide polymorphisms in the human heat shock protein 90 kDa ? and ? isoforms.
22022502 2011 An interaction network predicted from public data as a discovery tool: application to the Hsp90 molecular chaperone machine.
22019372 2011 Inhibition of RPE cell sterile inflammatory responses and endotoxin-induced uveitis by a cell-impermeable HSP90 inhibitor.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21855797 2011 Hsp90-Cdc37 chaperone complex regulates Ulk1- and Atg13-mediated mitophagy.
21689689 2011 TRIM8 regulates Nanog via Hsp90?-mediated nuclear translocation of STAT3 in embryonic stem cells.
21602280 2011 Impaired infectivity of ritonavir-resistant HIV is rescued by heat shock protein 90AB1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
20946244 2011 Role of CypA and Hsp90 in membrane translocation mediated by anthrax protective antigen.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20705598 2010 Identification of genes for normalization of quantitative real-time PCR data in ovarian tissues.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618441 2010 CHIP participates in protein triage decisions by preferentially ubiquitinating Hsp70-bound substrates.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20451655 2010 HSP90beta interacts with Rac1 to activate NADPH oxidase in Helicobacter pylori-infected gastric epithelial cells.
20353823 2010 Stat1 mediates an auto-regulation of hsp90beta gene in heat shock response.
20226818 2010 Mutations that increase both Hsp90 ATPase activity in vitro and Hsp90 drug resistance in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19996313 2010 Celastrol inhibits Hsp90 chaperoning of steroid receptors by inducing fibrillization of the Co-chaperone p23.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19858214 2009 Characterization of celastrol to inhibit hsp90 and cdc37 interaction.
19802386 2009 COMMD1 Promotes pVHL and O2-Independent Proteolysis of HIF-1alpha via HSP90/70.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19696785 2009 Hsp90 is regulated by a switch point in the C-terminal domain.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19576239 2009 Expression of Hsp90 chaperone [corrected] proteins in human tumor tissue.
19380486 2009 Caspase-10-mediated heat shock protein 90 beta cleavage promotes UVB irradiation-induced cell apoptosis.
19375531 2009 XAP2 inhibits glucocorticoid receptor activity in mammalian cells.
19327008 2009 Heat shock protein-90 beta is expressed at the surface of multipotential mesenchymal precursor cells: generation of a novel monoclonal antibody, STRO-4, with specificity for mesenchymal precursor cells from human and ovine tissues.
19254810 2009 The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticosteroids.
19047110 2008 Heat shock protein 90 overexpression independently predicts inferior disease-free survival with differential expression of the alpha and beta isoforms in gastrointestinal stromal tumors.
19022436 2009 A block in the road to fertility: autoantibodies to heat-shock protein 90-beta in human ovarian autoimmunity.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18818696 2008 Structural and functional coupling of Hsp90- and Sgt1-centred multi-protein complexes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18620420 2008 Role of the cochaperone Tpr2 in Hsp90 chaperoning.
18591256 2008 Inhibition of apoptosome formation by suppression of Hsp90beta phosphorylation in tyrosine kinase-induced leukemias.
18412542 2008 Chaperone ligand-discrimination by the TPR-domain protein Tah1.
18400751 2008 Conserved conformational changes in the ATPase cycle of human Hsp90.
18347946 2008 Substitution of only two residues of human Hsp90alpha causes impeded dimerization of Hsp90beta.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18285346 2008 GCUNC45 is the first Hsp90 co-chaperone to show alpha/beta isoform specificity.
18239673 2008 Interaction of heat-shock protein 90 beta isoform (HSP90 beta) with cellular inhibitor of apoptosis 1 (c-IAP1) is required for cell differentiation.
18088087 2008 Phosphoproteome of resting human platelets.
18042044 2008 Two different classes of E2 ubiquitin-conjugating enzymes are required for the mono-ubiquitination of proteins and elongation by polyubiquitin chains with a specific topology.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17764690 2007 Conformational dynamics of the molecular chaperone Hsp90 in complexes with a co-chaperone and anticancer drugs.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16809764 2006 Histone deacetylase 8 safeguards the human ever-shorter telomeres 1B (hEST1B) protein from ubiquitin-mediated degradation.
16698020 2006 Interaction of pro-apoptotic protein HGTD-P with heat shock protein 90 is required for induction of mitochondrial apoptotic cascades.
16582619 2006 Identification of novel ARF binding proteins by two-hybrid screening.
16580629 2006 SGT, a Hsp90beta binding partner, is accumulated in the nucleus during cell apoptosis.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16478993 2006 GCUNC-45 is a novel regulator for the progesterone receptor/hsp90 chaperoning pathway.
16330544 2006 Chaperoning checkpoint kinase 1 (Chk1), an Hsp90 client, with purified chaperones.
16314389 2006 Interaction of Hsp90 with ribosomal proteins protects from ubiquitination and proteasome-dependent degradation.
16293251 2005 CHIP interacts with heat shock factor 1 during heat stress.
16280321 2006 The heat shock protein 90-CDC37 chaperone complex is required for signaling by types I and II interferons.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.
16263121 2005 A proteomic snapshot of the human heat shock protein 90 interactome.
16248461 2005 [Study on the expression of HSP70 and HSP90beta in nasopharyngeal carcinoma and the clinical significance].
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15870294 2005 Identification and characterization of SSTK, a serine/threonine protein kinase essential for male fertility.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15791211 2005 Interaction of HSP90 to N-WASP leads to activation and protection from proteasome-dependent degradation.
15657067 2005 Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15581363 2004 Phosphorylation analysis of 90 kDa heat shock protein within the cytosolic arylhydrocarbon receptor complex.
15497503 2004 Interaction of the Hsp90 cochaperone cyclophilin 40 with Hsc70.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15284248 2004 Repression of hsp90beta gene by p53 in UV irradiation-induced apoptosis of Jurkat cells.
15217611 2004 Structure-activity relationships in purine-based inhibitor binding to HSP90 isoforms.
15159550 2004 3D structure of human FK506-binding protein 52: implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697242 2004 Chromosome 13q12 encoded Rho GTPase activating protein suppresses growth of breast carcinoma cells, and yeast two-hybrid screen shows its interaction with several proteins.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14532285 2003 PKC epsilon is a unique regulator for hsp90 beta gene in heat shock response.
12559950 2003 Involvement of heat-shock protein 90 in the interleukin-6-mediated signaling pathway through STAT3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11795466 2001 The N-terminal adenosine triphosphate binding domain of Hsp90 is necessary and sufficient for interaction with estrogen receptor.
11707401 2001 Co-chaperones Bag-1, Hop and Hsp40 regulate Hsc70 and Hsp90 interactions with wild-type or mutant p53.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11099500 2001 Interaction of the type IIa Na/Pi cotransporter with PDZ proteins.
11036079 2001 Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase.
10995457 2000 Modulation of Akt kinase activity by binding to Hsp90.
10376793 1999 Expression of hsp90 and cyclin D1 in human breast cancer.
9482106 1998 Active cdk6 complexes are predominantly nuclear and represent only a minority of the cdk6 in T cells.
9150948 A two-dimensional gel database of human colon carcinoma proteins.
8180474 1994 A cosmid clone at the D6S182 locus on human chromosome 6p12 contains the 90-kDa heat shock protein beta gene (HSP90 beta).
7821789 1994 Construction of a human full-length cDNA bank.
7588731 1995 Mechanism of dimer formation of the 90-kDa heat-shock protein.
7581991 1995 Evidence for oestrogenic regulation of heat shock protein expression in human endometrium and steroid-responsive cell lines.
3301534 1987 Nucleotide sequence of a cDNA for a member of the human 90-kDa heat-shock protein family.
2768249 1989 Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene.
2492519 1989 Two human 90-kDa heat shock proteins are phosphorylated in vivo at conserved serines that are phosphorylated in vitro by casein kinase II.
2469626 1988 Heat-shock proteins, Hsp84 and Hsp86, of mice and men: two related genes encode formerly identified tumour-specific transplantation antigens.