Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.30
PubTator Score 9.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (3)

AA Sequence

MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPGDSDLRSMIEEHAFQVLSQGSLLESPSYTVCVSEPD      1 - 70
KDDDFLSLNFPRKLWKIVESDQFKSISWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNL     71 - 140
YGFSKIQQNFQRSAFLATFLSEEKESSVLSKLKFYYNPNFKRGYPQLLVRVKRRIGVKNASPISTLFNED    141 - 210
FNKKHFRAGANMENHNSALAAEASEESLFSASKNLNMPLTRESSVRQIIANSSVPIRSGFPPPSPSTSVG    211 - 280
PSEQIATDQHAILNQLTTIHMHSHSTYMQARGHIVNFITTTTSQYHIISPLQNGYFGLTVEPSAVPTRYP    281 - 350
LVSVNEAPYRNMLPAGNPWLQMPTIADRSAAPHSRLALQPSPLDKYHPNYN                       351 - 401
//

Text Mined References (11)

PMID Year Title