Property Summary

NCBI Gene PubMed Count 35
PubMed Score 629.12
PubTator Score 64.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.670 4.7e-08
glioblastoma -1.100 1.1e-02

 GO Component (1)

Gene RIF (27)

PMID Text
26319152 BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.
26003728 Nuclear HSF2 and HSF4 bound to HSF1 only after heat shock.
25940838 HSF4 may work as a switch between lens epithelial cell proliferation and secondary fiber cell differentiation, a process which mainly depends on p53.
25877371 concluded that the new mutation of c.331C>T in HSF4 DNA may be responsible for the autosomal dominant congenital cataract in this family
25088997 We found that HSF4 downregulation led to decrease of HIF1alpha mRNA expression
24975927 HSF4 p.Arg116His recreates the childhood lamellar cataract in mice suggesting that incomplete penetrance associated with early cataracts may not be an absence but a limitation of the detection of the phenotype
24637349 This is the first report of the novel missense mutation, c.69 G-->T (p. K23N), in exon 3 of the HSF4 locus on 16q21-q22 associated with bilateral congenital cataracts in a Chinese family.
24045990 the transcriptional activation of HSF4 is mediated by interactions between activator and repressor domains within the C-terminal end.
23507146 HSF4 exerts its function on lens differentiation via positive regulation of DLAD expression.
23329665 HSF4 and WRN CNVs might be involved in ARC pathogenesis in the Han Chinese.
23264262 This comparative analysis with CRYAB and HSP70 demonstrates that differential heat shock response is controlled by cell-type-dependent access of HSF1 and HSF4 to specific promoters, independent of the promoter architecture.
22587838 Presents the first evidence demonstrating that HSF4 plays a role in DNA damage repair and may contribute a better understanding of congenital cataract formation.
22103961 we report the absence of mutations in all studied genes in four families with phenotypes associating cataract, mental retardation and microcephaly.
21792930 our findings suggest novel mechanisms of HSF2 regulation controlled by HSF4a.
21258402 HSF2 and HSF4 regulate transcription of HIF-1a and that a critical balance between these HSF is required to maintain HIF-a expression in a repressed state.
20670914 two missense mutations that have been associated with age-related cataract did not or only slightly alter HSF4 activity, implying that other genetic and environmental factors affect the functions of these mutant proteins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20564821 Hsf4b could interact with and phosphorylated by MAP kinase P38.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19014451 we have shown the first nonsense mutation in HSF4 causing autosomal recessive cataracts in a large consanguineous family from Pakistan
18941546 This result indicates that HSF4 mutations account for only a small fraction of age-related cataracts.
16876512 These results identified a novel missense mutation R74H in the transcription factor gene HSF4 in a Chinese cataract family and expand the spectrum of HSF4 mutations causing cataract.
16552721 The results indicate that in the absence of Hsf1 and Hsf2, Hsf4b expression in cells leads to increased ability of Hsf4b to bind HSE during G1, leading to enhanced synthesis of inducible Hsp70.
15959809 Findings confirm that mutations in HSF4 may result in both autosomal dominant and autosomal recessive congenital cataract, and highlight the locus heterogeneity in autosomal recessive congenital cataract.
15308659 HSF4 binds to alphaB-crystallin, Hsp70, and Hsp82 promoters and has a role in interacting with the canonical heat shock element of the alphaB-crystallin gene
15277496 This is the first report describing association of an autosomal recessive cataract with the HSF4 locus on 16q21-q22.1 and the first description of HSF4 splice variants
12089525 Mutant DNA-binding domain of HSF4 is associated with autosomal dominant lamellar and Marner cataract. . We suggest that HSF4 is critical to lens development.

AA Sequence

MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMAS      1 - 70
FVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGREQLLERVRRKVPALRGDDGRWRPEDLGRLL     71 - 140
GEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLS    141 - 210
LMLDEGSSCPTPAKFNTCPLPGALLQDPYFIQSPLPETNLGLSPHRARGPIISDIPEDSPSPEGTRLSPS    211 - 280
SDGRREKGLALLKEEPASPGGDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRNAQQP    281 - 350
EPGDPREIPDRGPLGLESGDRSPESLLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQ    351 - 420
PLVPERGEPELAVKGLNSPSPGKDPTLGAPLLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASP    421 - 490
SP                                                                        491 - 492
//

Text Mined References (38)

PMID Year Title
26319152 2015 BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.
26003728 2015 Heat shock-induced interactions among nuclear HSFs detected by fluorescence cross-correlation spectroscopy.
25940838 2015 HSF4 promotes G1/S arrest in human lens epithelial cells by stabilizing p53.
25877371 2015 A novel HSF4 mutation in a Chinese family with autosomal dominant congenital cataract.
25088997 2014 Effect of HSF4b on age related cataract may through its novel downstream target Hif1?.
24975927 2014 HSF4 mutation p.Arg116His found in age-related cataracts and in normal populations produces childhood lamellar cataract in transgenic mice.
24637349 2014 A novel HSF4 gene mutation causes autosomal-dominant cataracts in a Chinese family.
24045990 2013 Functional analysis of HSF4 mutations found in patients with autosomal recessive congenital cataracts.
23507146 2013 HSF4 regulates DLAD expression and promotes lens de-nucleation.
23329665 2013 Copy number variations of DNA repair genes and the age-related cataract: Jiangsu Eye Study.
23264262 2013 Cell-type-dependent access of HSF1 and HSF4 to ?B-crystallin promoter during heat shock.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
22587838 2012 HSF4 is involved in DNA damage repair through regulation of Rad51.
22103961 2011 Absence of mutations in four genes encoding for congenital cataract and expressed in the human brain in Tunisian families with cataract and mental retardation.
21792930 2012 Heat shock factor 4a (HSF4a) represses HSF2 expression and HSF2-mediated transcriptional activity.
21258402 2011 Regulation of transcription of hypoxia-inducible factor-1? (HIF-1?) by heat shock factors HSF2 and HSF4.
20670914 2010 DNA-binding and transcriptional activities of human HSF4 containing mutations that associate with congenital and age-related cataracts.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20564821 2010 [Construction of eukaryotic plasmid expression Hsf4b and phosphorylation of Hsf4b by MAP kinase P38].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19014451 2008 A novel HSF4 gene mutation (p.R405X) causing autosomal recessive congenital cataracts in a large consanguineous family from Pakistan.
18941546 2008 Mutation screening of HSF4 in 150 age-related cataract patients.
16876512 2006 Novel HSF4 mutation causes congenital total white cataract in a Chinese family.
16581800 2006 Association and regulation of heat shock transcription factor 4b with both extracellular signal-regulated kinase mitogen-activated protein kinase and dual-specificity tyrosine phosphatase DUSP26.
16552721 2006 Heat shock transcription factor (Hsf)-4b recruits Brg1 during the G1 phase of the cell cycle and regulates the expression of heat shock proteins.
16371476 2006 PDSM, a motif for phosphorylation-dependent SUMO modification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15959809 2005 Locus heterogeneity in autosomal recessive congenital cataracts: linkage to 9q and germline HSF4 mutations.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15308659 2004 Developmentally dictated expression of heat shock factors: exclusive expression of HSF4 in the postnatal lens and its specific interaction with alphaB-crystallin heat shock promoter.
15277496 2004 A homozygous splice mutation in the HSF4 gene is associated with an autosomal recessive congenital cataract.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12089525 2002 Mutant DNA-binding domain of HSF4 is associated with autosomal dominant lamellar and Marner cataract.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10488131 1999 The mammalian HSF4 gene generates both an activator and a repressor of heat shock genes by alternative splicing.
8972228 1997 HSF4, a new member of the human heat shock factor family which lacks properties of a transcriptional activator.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.