Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.43
PubTator Score 1.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQE      1 - 70
LEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEV     71 - 140
VKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVL    141 - 210
LDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQ    211 - 280
SVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV                    281 - 334
//

Text Mined References (11)

PMID Year Title