Property Summary

NCBI Gene PubMed Count 44
PubMed Score 12.79
PubTator Score 64.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 4.4e-07
acute quadriplegic myopathy 1157 5.3e-07
ovarian cancer 8491 1.6e-06
group 4 medulloblastoma 1875 1.5e-05
psoriasis 6685 1.7e-05
lung cancer 4473 1.8e-05
osteosarcoma 7933 5.6e-03
Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.400 4.4e-07
psoriasis -2.300 1.7e-05
osteosarcoma 1.977 5.6e-03
group 4 medulloblastoma 1.700 1.5e-05
acute quadriplegic myopathy 1.356 5.3e-07
lung cancer 2.300 1.8e-05
ovarian cancer -1.500 1.6e-06

Gene RIF (27)

PMID Text
26727490 Presented are the crystal structures of the human HSF2 DNA-binding domain (DBD) bound to DNA.
26478434 HSF2 can induce histone activation.Set1/MLL complex is indispensable for the transcriptional ability of HSF2.
26260034 the findings of our studys suggest that HSF2 contributes to its own expression by forming a negative autoregulatory loop.
26119944 This study provides the first evidence for HSF2 acting as a suppressor of invasion in human malignancies.
26003728 Nuclear HSF2 and HSF4 bound to HSF1 only after heat shock.
25202032 the condensed chromatin of HSF2-deficient cells is accessible for HSF1 and RNA polymerase II, allowing stress-inducible Hsp expression.
24619424 Data indicate that both heat shock factors HSF1 and HSF2 are recruited to the arsenite-inducible RNA-associated protein (AIRAP) promoter and regulate bortezomib-induced AIRAP expression.
24533153 HSF2 appears to be a potential novel molecular marker for ulcerative colitis
23959860 Results indicate the importance of the cell cycle phase in transcriptional responses and identify the specific mechanisms for HSF1 and HSF2 in transcriptional orchestration.
23064888 These results support a role for HSF2 in the pathogenesis of IA and further implicate this transcription factor as a potential therapeutic target.
21792930 our findings suggest novel mechanisms of HSF2 regulation controlled by HSF4a.
21258402 HSF2 and HSF4 regulate transcription of HIF-1alpha and that a critical balance between these HSFs is required to maintain HIF-alpha expression in a repressed state.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19768582 Data show that the PEST sequences of a short-lived protein called HSF2 interact with Cullin3, a subunit of a Cullin-RING E3 ubiquitin ligase, and that this interaction mediates the Cul3-dependent ubiquitination and degradation of HSF2.
19129477 HSF1-HSF2 heterotrimerization regulates stress-induced transcription
19017645 NMR study of the SUMOylated DNA binding domain of HSF2 indicates that the SUMO moiety is flexible with respect to the DNA binding domain and has neither a noncovalent interface with nor a structural effect on the domain
18978678 Observational study of gene-disease association. (HuGE Navigator)
18570919 These results provide a potential mechanistic basis for the defective cytokinesis phenotype exhibited by HSF2-/- cells, as well as suggest a potential role for PRC1 in HSF2-mediated gene bookmarking.
18211895 MEL-18 bound to HSF2 inhibits its sumoylation by binding to and inhibiting the activity of UBC9 enzymes in the vicinity of HSF2.
17915561 During mitosis, HSF2 is bound to the HSE promoter elements of other heat shock genes, including hsp90 and hsp27, and the proto-oncogene c-fos. The presence of HSF2 is important for expression of these genes.
17688198 The results of these experiments indicate that the HSF2 region comprising amino acids 343-363 is important for A subunit interaction.
17213196 Both HSF1 and HSF2 were able to bind the hsp70 promoter not only in response to heat shock but also during hemin-induced differentiation of K562 erythroleukemia cells.
15662014 results show hsp70i bookmarking is mediated by HSF2 which binds this promoter in mitotic cells, recruits protein phosphatase 2A & interacts with the CAP-G subunit of condensin to promote dephosphorylation & inactivation of condensin complexes
14699143 HSF1 has a role in transcriptional regulation of the human RANK ligand gene
12865437 HSF2 influences to the formation of nuclear stress granules
12813038 elevated expression of heat shock factor (HSF) 2A stimulates HSF1-induced transcription during oxidative stress in cancer cells
11795475 characterization of the hsf2 gene and its 5'-flanking region

AA Sequence

MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGF      1 - 70
RKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQ     71 - 140
ETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKK    141 - 210
NLFQHIVKEPTDNHHHKVPHSRTEGLKPRERISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQ    211 - 280
YPDIVIVEDDNEDEYAPVIQSGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILND    281 - 350
NINLLGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTK    351 - 420
NNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSS    421 - 490
LDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS                            491 - 536
//

Text Mined References (48)

PMID Year Title
26727490 2016 Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
26478434 2015 Set1/MLL complex is indispensable for the transcriptional ability of heat shock transcription factor 2.
26260034 2015 HSF2 autoregulates its own transcription.
26119944 2016 Heat-shock factor 2 is a suppressor of prostate cancer invasion.
26003728 2015 Heat shock-induced interactions among nuclear HSFs detected by fluorescence cross-correlation spectroscopy.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25202032 2014 Expression of HSF2 decreases in mitosis to enable stress-inducible transcription and cell survival.
24619424 2014 The proteasome inhibitor bortezomib is a potent inducer of zinc finger AN1-type domain 2a gene expression: role of heat shock factor 1 (HSF1)-heat shock factor 2 (HSF2) heterocomplexes.
24533153 2014 Heat shock factor 2 levels are associated with the severity of ulcerative colitis.
23959860 2013 Transcriptional response to stress in the dynamic chromatin environment of cycling and mitotic cells.
23064888 2013 A dominant-negative mutation of HSF2 associated with idiopathic azoospermia.
21792930 2012 Heat shock factor 4a (HSF4a) represses HSF2 expression and HSF2-mediated transcriptional activity.
21258402 2011 Regulation of transcription of hypoxia-inducible factor-1? (HIF-1?) by heat shock factors HSF2 and HSF4.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19768582 2010 PEST sequences mediate heat shock factor 2 turnover by interacting with the Cul3 subunit of the Cul3-RING ubiquitin ligase.
19129477 2009 Heterotrimerization of heat-shock factors 1 and 2 provides a transcriptional switch in response to distinct stimuli.
19017645 2009 Molecular basis for SUMOylation-dependent regulation of DNA binding activity of heat shock factor 2.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18570919 2008 PRC1 associates with the hsp70i promoter and interacts with HSF2 during mitosis.
18211895 2008 MEL-18 interacts with HSF2 and the SUMO E2 UBC9 to inhibit HSF2 sumoylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17915561 2007 HSF2 binds to the Hsp90, Hsp27, and c-Fos promoters constitutively and modulates their expression.
17688198 2007 Identification of the PP2A-interacting region of heat shock transcription factor 2.
17213196 2007 Heat shock factor 2 (HSF2) contributes to inducible expression of hsp genes through interplay with HSF1.
16428449 2006 Inhibition of DNA binding by differential sumoylation of heat shock factors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15662014 2005 Mechanism of hsp70i gene bookmarking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699143 2004 Functional role for heat shock factors in the transcriptional regulation of human RANK ligand gene expression in stromal/osteoblast cells.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12865437 2003 Formation of nuclear stress granules involves HSF2 and coincides with the nucleolar localization of Hsp70.
12813038 2003 Elevated expression of heat shock factor (HSF) 2A stimulates HSF1-induced transcription during stress.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278381 2001 Sumo-1 modification regulates the DNA binding activity of heat shock transcription factor 2, a promyelocytic leukemia nuclear body associated transcription factor.
10561509 1999 Transcriptional activation of mouse cytosolic chaperonin CCT subunit genes by heat shock factors HSF1 and HSF2.
10224043 1999 Regulation of protein phosphatase 2A activity by heat shock transcription factor 2.
9651507 1998 Novel testis-specific protein that interacts with heat shock factor 2.
9367915 1997 The trimerization domain of human heat shock factor 2 is able to interact with nucleoporin p62.
9118008 1997 Heat shock and the role of the HSPs during neural plate induction in early mammalian CNS and brain development.
8339932 1993 Hydrophobic coiled-coil domains regulate the subcellular localization of human heat shock factor 2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1871106 1991 Isolation of a cDNA for HSF2: evidence for two heat shock factor genes in humans.
1717345 1991 Cloning and characterization of two mouse heat shock factors with distinct inducible and constitutive DNA-binding ability.