Property Summary

NCBI Gene PubMed Count 234
PubMed Score 207.50
PubTator Score 532.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
AMYOTROPHIC LATERAL SCLEROSIS 1 49
Disease Target Count P-value
Breast cancer 3098 2.7e-04
medulloblastoma, large-cell 6234 9.2e-04
Disease Target Count Z-score Confidence
Huntington's disease 72 3.477 1.7
Cancer 2346 3.124 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 9.2e-04
Breast cancer 1.100 2.7e-04

Gene RIF (187)

PMID Text
26785146 The authors found a temperature-dependent unfolding of Hsf1 in the regulatory region happening concomitant to tighter packing in the trimerization region.
26727489 The study presents cocrystal structures of the human HSF1 DNA-binding domain in complex with cognate DNA.
26511079 interaction of tumor cells and stromal fibroblasts increases the expression of HSF1 reciprocally in tumor microenvironment
26504030 High expression of HSF1 is associated with pancreatic cancer.
26503960 Aberrant HSF1 degradation is a key neurodegenerative mechanism underlying alpha-synucleinopathy. Elevated NEDD4 is implicated as the responsible ubiquitin E3 ligase for HSF1 degradation through ubiquitin-proteasome system.
26496226 oligomeric IER5 regulates PP2A activity and cell growth
26473447 High HSF1 expression is associated with acute myeloid leukemia.
26427350 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions
26361762 Phosphorylation of HSF1 at Ser230 is responsible for Hsp70-1 upregulation during coxsackieviral infection.
26359349 Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability.
26320184 Suggest that the early activation of Hsf1 dependent cell stress pathway by mono-allelic mutations in APC can affect cell programming in a way that contributes to cancer onset.
26298773 Data show that tonantzitlolone (TZL) was able to induce protein kinase c theta (PKCtheta;)-dependent heat shock transcription factor 1 (HSF1)phosphorylation.
26223813 our study indicates that one of the potential HSP-independent HSF1 driven mechanisms that may contribute to poor outcome in human tumors involves regulation of the CSC phenotype.
26193369 Data show that active GTP binding protein RhoA negatively regulates the heat shock response (HSR) via attenuation of the heat shock transcription factor 1 (HSF1)-heat shock elements (HSE) binding of HSP70 (HSPA1A) promoter.
26184999 These results suggest that STAT3 inhibition, by down-regulating the expression of HSF1/HSP70, reduces Mcl-1 and leads to both apoptosis and autophagy induction in PEL cells.
26159920 BAG3 plays a key role in the processing of the nucleocytoplasmic shuttling of HSF1 upon heat stress
26157141 CLD1-mediated hepatoma cell invasiveness occurs via heat shock factor 1 (HSF1) activation.
26108999 HSF1 plays many important roles in cancer via regulating cell proliferation, anti-apoptosis, epithelial-mesenchymal transition (EMT), migration, invasion, and metastasis and may be a potential therapeutic target for human cancers.
26010766 Glucose, but not 2D-glucose, can induce the phosphorylation of HSF1 at S326 and upregulate the expression of HSF1's downstream alpha B-crystallin and Hsp70
26003728 Nuclear HSF2 and HSF4 bound to HSF1 only after heat shock.
25982096 Our data indicate a new direction for LOX-1 regulation by the modulation of the PKCbeta/NAPDH oxidase/SIRT1/HSF1 mechanism
25816751 IER5 functions as a positive feedback regulator of HSF1 and that this process involves PP2A/B55 and HSF1 dephosphorylation.
25762445 SSBP1 protects cells from proteotoxic stresses by potentiating stress-induced HSF1 transcriptional activity
25720964 FBXW7 modulates cellular stress response and metastatic potential through HSF1 post-translational modification.
25679764 Findings not only suggest HSF1 as a new MEK substrate but also uncover a biological function of RAS-MEK-ERK signaling in governing proteostasis.
25537516 Data show that heat shock transcription factor 1/miR-135b/reversion-inducing-cysteine-rich protein with kazal motifs and ecotropic viral integration site 5 axis provides novel insight into the mechanisms of hepatocellular carcinoma metastasis.
25437552 HSF1 is directly regulated by TRiC/CCT, a central ATP-dependent chaperonin complex that folds cytosolic proteins.
25430510 HSF1 can directly bind the HSE in the Dp71 promoter region.
25425574 these findings uncover a novel interplay between the metabolic stress sensor AMPK and the proteotoxic stress sensor HSF1 that profoundly impacts stress resistance, proteostasis, and malignant growth.
25406061 silencing increases F508del-CTFR folding, trafficking, and function and improves the phenotype of other misfolding diseases
25380824 These data define a novel link between DAPK and HSF1 and highlight a positive-feedback loop in DAPK regulation under mild inflammatory stress conditions in colorectal tumors.
25355627 These observations suggest that HSF1-mediated IER5 expression is involved in the expression of chaperone genes and in recovery from thermal stress.
25310819 Defective HSF1 upregulated the protein expression of p53.
25280995 report uncovers a novel function of HSF1 and indicates involvement of miRNAs in HSF1-mediated protection of cellular proteome
25205676 Increased levels of HSF1 counteract the effects of aneuploidy on HSP90 expression and protein folding, identifying HSF1 overexpression as the first aneuploidy-tolerating mutation in human cells.
25204655 A role for specific orientations of extended heat shock element sequences in driving preferential HSF1 DNA binding to target loci in vivo.
25199534 Knockdown of HSF1 with shRNA induced the protein expression of tumor suppressor retinoblastoma protein, resulting in attenuated plc/prf5 cell growth and colony formation in vitro.
25199502 as many as four transcription factors are known to regulate the HMOX1 gene: HSF1, AP-1, NRF2, and NF-kappaB. To investigate induction kinetics of these transcription factors, we constructed mathematical simulation models for each of them
25194503 Results show that HSF1 is indispensable for melanoma progression and metastasis.
25083868 HSF1 drives a transcriptional program in cancer-associated fibroblasts (CAFs) that complements, yet is completely different from, the program it drives in adjacent cancer cells. This CAF program is uniquely structured to support malignancy in a non-cell-autonomous way.
24954509 HSF1 was positively regulated through phosphorylation by mammalian target of rapamycin (mTOR) kinase on a key residue, serine 326, essential for transcriptional activity.
24831003 MLL1 functions as a coactivator of HSF1 in response to HSP90 inhibition
24800749 HSF1 DNA binding activity is a potential target for controlling oncogenic transformation.
24763051 mutant p53 protein via direct interaction with activated p-Ser326 HSF1 facilitates HSF1 recruitment to its specific DNA-binding elements.
24726381 HSF1 plays a crucial role in the response of brain cells to prenatal environmental insults and may be a key component in the pathogenesis of late-onset neuropsychiatric disorders.
24619424 Data indicate that both heat shock factors HSF1 and HSF2 are recruited to the arsenite-inducible RNA-associated protein (AIRAP) promoter and regulate bortezomib-induced AIRAP expression.
24581496 Based on analysis, HSF1 activation upon heat shock involves the function of multiple chromatin modifiers, centering on the EP300/CREBBP histone acetyltransferase complex. Silencing of EP300 destabilizes HSF1 in nonstressed cells and induces its proteasomal degradation.
24516381 Activation of HSF1 was supportive for Orthopoxviridae virus replication
24504023 HSF1 appears as a fine-tuning regulator of SPI1/PU.1 expression at the transcriptional and post-translational levels during macrophage differentiation of monocytes.
24478344 This study showed that HSF1 trimerization is not required for protection against mutant huntingtin-induced neurotoxicity.
24469056 Altogether, our study uncovered the existence of a novel Akt-HSF-1 signaling axis that leads to Slug upregulation and EMT, and potentially contributes to progression of HER2-positive breast cancer
24465598 Chaperone-like protein HYPK is induced by cellular stress and is under transcriptional regulation by HSF1.
24384723 ErbB2 overexpression controls HSF1 activity, with subsequent stabilization of tumor-promoting HSP90 target, MIF.
24361604 maintenance of HYPK expression by HSF1 is necessary for the survival of cells under thermal stress conditions
24256636 This is the first study to demonstrate that over-expression of full-length HSF1 is beneficial in amyotrophic lateral sclerosis
24165036 Overexpression of Heat Shock Transcription Factor 1 enhances the resistance of melanoma cells to doxorubicin and paclitaxel.
24130164 Heat shock factor 1 accelerates hepatocellular carcinoma development by activating nuclear factor-kappaB/mitogen-activated protein kinase.
24126052 PIN1 acts as a stress sensor regulating HSF1 activity in response to stress on multiple levels through the transcriptional activation of stress response elements.
24123326 we show that heat shock induces exosomal transfer of HSF1 from Sca-1(+) cells, which directs ischemic cardiomyocytes toward a prosurvival phenotype by epigenetic repression of miR-34a
24002609 High peritumoral HSF1 expression can serve as a sensitive 'readout' for high-risk HCC ER, and could be a potential metabolic intervention target following curative resection.
23959860 Results indicate the importance of the cell cycle phase in transcriptional responses and identify the specific mechanisms for HSF1 and HSF2 in transcriptional orchestration.
23959823 FUT4 is a target gene for HSF1 and Sp1 that is required for cell cycle progression in breast cancer epithelial cells.HSF1 and Sp1 regulate FUT4 gene expression and cell proliferation in breast cancer cells.
23902341 Enhanced sensitivity of colon tumour cells to natural killer cell cytotoxicity after mild thermal stress is regulated through HSF1-mediated expression of MICA.
23869022 a dominant transcriptional effect of blocking protein translation in cancer cells was inactivation of heat shock factor 1 (HSF1), a multifaceted transcriptional regulator of the heat-shock response and many other cellular processes essential for anabolic metabolism, cellular proliferation, and tumorigenesis.
23861773 HSF1 dynamics modifications upon heat shock result from both formation of high molecular weight complexes and increased HSF1 interactions with chromatin.
23733891 HSF1 DNA binding is regulated in a locus-dependent manner, via promoter-specific differences in chromatin architecture.
23587726 Stress-induced transcription of regulator of G protein signaling 2 (RGS2) by heat shock transcription factor HSF1
23587601 TRAIL induced HSF1 inactivation leads to the suppression of Hsp47-dependent collagen production in activated human hepatic stellate cells.
23542779 These results demonstrate that the duplicated heat shock elements and HSF1 constitute the mechanism for the heavy metal response of hsp70, which is distinct from the known metal regulatory system for the metallothionein genes.
23511056 AGE can dose-dependently promote HCAEC apoptosis by the PI3K/AKT pathway. Atorvastatin may attenuate the effect possibly by upregulating HSF-1.
23510323 HSF1 affects clonogenic growth in a p53 context-dependent manner and can act via both mutant and wild-type p53 to bring about divergent effects upon clonogenicity.
23388456 HSF1/SESN3/reactive oxygen species/p21(Cip1/WAF1)-mediated deceleration of cell growth may contribute to cell defense systems protecting the organism from excessive proliferation of cells that overexpress activated Ras oncoproteins.
23386620 Heat shock factor 1 (HSF1) controls chemoresistance and autophagy through transcriptional regulation of autophagy-related protein 7 (ATG7)
23349863 we found that the SIRT1 modulators AROS and DBC1 have an impact on hsp70 transcription, HSF1 acetylation status, and HSF1 recruitment to the hsp70 promoter
23321918 Inactivation of HSF1 affects the timing and nature of the antioxidant response and NRF2 can activate at least some HSF1 target genes in the absence of HSF1 activity.
23293686 Studied the effects of mutant Htt on HSF1; found under normal conditions, HSF1 function is highly similar in cells carrying either wild-type or mutant Htt, but polyQ-expanded Htt severely blunts the HSF1-mediated stress response.
23264262 This comparative analysis with CRYAB and HSP70 demonstrates that differential heat shock response is controlled by cell-type-dependent access of HSF1 and HSF4 to specific promoters, independent of the promoter architecture.
23252346 our data strongly suggest a potential role of HSF1 in the pathogenesis of multiple myeloma and its inhibition critically affects multiple tumourigenic HSPs and might therefore represent an attractive therapeutic strategy.
23192351 FoxM1 is regulated by HSF1 and promotes cell cycle progression and cancer cell survival under heat stress conditions.
23180277 HSF1-induced taurine transporter expression protects motor neurons by compensating for oxidative stress in amyotrophic lateral sclerosis.
23121022 Proteins with chaperone-like activity are overrepresented among proteins up-regulated in a transgenic mice model, and the master regulator HSF1 is activated.
22981541 heat shock treatment could activate the expression of SPATA12 and transcription factor HSF binding sites in the SPATA12 promoter might be responsible for this heat-induction
22945628 In cell lines from human malignant peripheral nerve sheath tumors driven by NF1 loss, HSF1 was overexpressed & activated, which was required for tumor cell viability.
22940245 Depletion of RPA1 abolishes HSF1 access to the promoter of HSP70 in unstressed condition and delays its rapid activation in response to heat shock.
22863008 Study identified an HSF1-regulated transcriptional program specific to highly malignant cells and distinct from heat shock. Cancer-specific genes in this program support oncogenic processes: cell-cycle regulation, signaling, metabolism, adhesion and translation.
22768106 mTOR could directly phosphorylate HSF1 on serine 326, a key residue in transcriptional activation.
22510478 uncovered a positive feedback regulation, where suppression of Hsf1 further activates the p38-NF-kappaB-SASP pathway, which in turn promotes senescence
22443056 UVA irradiation could stimulate the activation of HSF1 and increase HSP70 protein expression in HaCaT cells, which inhibited activation of JNK, thus preventing apoptosis.
22347460 COX-2 transcription is also induced at febrile temperatures in endothelial cells, suggesting that HSF1-dependent COX-2 expression could contribute to increasing blood prostaglandin levels during fever
22266185 compound targets heat shock response pathways by down-regulation of heat shock transcription factor 1 and consequential down-regulation of multiple heat shock proteins HSP27, HSP70 and HSP90
22042860 findings indicate that HSF1 should be evaluated prospectively as an independent prognostic indicator in ER-positive breast cancer
22018489 These results provide evidence that EBNA1 is a new target for the transcription factor HSF1.
22009757 HSF1 was capable of promoting HCC cell migration and invasion in vitro and in vivo by facilitating the expression and phosphorylation of heat shock protein 27.
21883218 Activation of nuclear factor erythroid 2-related factor 2 and HSF-1 induces phase 2 enzymes and heat-shock protein pathways, respectively.
21879256 Among the clinical classifications, higher nuclear HSF1 expression was closely related to tumor size and histopathologic types. These results showed for the first time that nuclear HSF1 expression may contribute to cancer progression.
21784850 a novel function for FILIP-1L and a pathway for Hsf1 degradation through the ubiquitin-proteasome system.
21557666 HSF1 plays an important role in checkpoint activation and DNA repair
21480956 HSF1 and major HSP's are expressed strongly in classical Hodgkin lymphoma.
21459854 Activation of HSP27 is mediated through heat shock factor 1 and is counteracted by HIV-1 Vpr
21361146 HSF1 expression was increased in HepG2 cells during cooling and rewarming. Cellular response to hypothermia could be associated with the synergistic induction of Hsp expression.
21353370 increased in pre-eclamptic endothelial cells
21330448 HSF1 plays a prosurvival role in the pathogenesis of pancreatobiliary tumors.
21299508 The expression of HSP70 and HSF1 was increased in preeclamptic subjects as compared with that in normotensive subjects.
21266308 analysis of gene-specific effect of heat shock on heat shock factor-1 recruitment and gene expression of CXC chemokine genes
21253609 mechanisms that regulate human HSF1 through phosphorylation of serine 303
21155232 hHSF1 can transcriptionally regulate prohibitin expression.
21098017 riluzole increased the amount and activity of HSF1 to boost the expression of HSPs and GLT1 for neuroprotection under stress.
21085490 Findings of PKA regulation of HSF1 through S320 phosphorylation show the signaling networks converging on this factor and may contribute to elucidating its complex roles in the stress response and understanding HSF1 dysregulation in disease.
21078672 KRIBB11 inhibits HSP70 synthesis through inhibition of heat shock factor 1 function by impairing the recruitment of positive transcription elongation factor b to the hsp70 promoter.
21044828 proliferation of MeWo cells treated with HSF1 shRNA was markedly reduced, and this was associated with a G block of the cell cycle, whereas HSF1 shRNA treatment of normal keratinocyte HaCat cells had no effect on proliferation
20941531 HSF1 protects cardiomyocytes from apoptosis under oxidative stress.
20834230 Data show that NFATc2 inhibits polyQ aggregation in cells and is required for HSF1-mediated suppression of aggregation, and that HSF1 and NFATc2 cooperatively induce expression of PDZK3 and alphaB-crystallin, which facilitate degradation of polyQ.
20630999 Results suggest that RAGE, NOX, and H-Ras/Raf-1 are implicated in the up-regulation of HSF1 or PAI-1 in vascular EC under diabetes-associated metabolic stress.
20459615 Constitutively active HSF1 enhances the Adel55 cell-killing potential through increasing the viral replication.
20396959 transcription factor of Fas gene
20198330 Knockdown of both PLK1 and HSF1 expression decreased cell proliferation while increasing apoptotic cell death in synergistic fashion in oral carcinoma cells.
20185824 The HSF1 binding HSE sequence in the AIRAP promoter critical for heat-induced transcription was identified.
20176657 HSF1 is an important transcription factor for induction of NAT1 in human cells and is required for androgen activation of the NAT1 promoter.
20152833 HSF1 binds to the pericentromeric region of 14 chromosomes, thereby directing the formation of 'secondary nuclear stress bodies'.
19844581 redox signaling is converted to apoptotic activities by stress-responsive regulators HSF1 and NRF2 in fenretinide treated cancer cells
19817876 protein expression of heat shock transcription factor 1 (HSF1), which activates HSPA1A expression, was down-regulated in L24 cells
19793920 Results identify HSF1 as a master regulator of global chromatin acetylation and reveals a cross-talk between HSF1 and histone deacetylases in the general control of genome organization in response to heat shock.
19758120 suggest that modulation of oligomerization is important for the heat-shock element specificity of hHSF1.
19668225 ErbB2 promotes glycolysis at least partially through the HSF1-mediated upregulation of LDH-A.
19609719 Dominant-positive HSF1 plays an important role in suppressing alpha-synuclein aggregation and toxicity in SH-SY5Y cells.
19597476 HSP27-induced HSF1 modification by SUMO-2/3 takes place downstream of the transcription factor phosphorylation on S303 and S307 and does not affect its DNA-binding ability
19517141 staining more prevalent in intervertebral disc cells associated with cell clusters
19486883 the presence of alpha-helix 1 stabilizes the DNA-binding domain structure, which facilitates the heat-induced trimerization and DNA-binding of HSF1.
19401454 Oxidized LDL-induced expression of NOX may lead to the elevated release of reactive oxygen species, the activation of HSF1, and the enhancement of the transcription of PAI-1 gene in cultured vascular endothelial cells.
19338268 existence of two differential interactions facilitates the formation of intermolecular disulfide bonds, leading to the heat-induced HSF1 trimerizatio
19335068 An overview of how HSF1 affects cancer biology & how its activity is regulated is followed by a summary of progress in discovery & development of inhibitors. Review.
19229036 results provide a mechanistic basis for the requirement of HSF1 in the regulation of life span and establish a role for SIRT1 in protein homeostasis and the heat shock response
19221897 HSF-1-mediated HSP72 expression following hyperthermia and heat shock appears to be mediated, in addition to HSF-1 activation, by posttranslational modifications of HSF-1 protein.
19129477 HSF1-HSF2 heterotrimerization regulates stress-induced transcription.
19097133 demonstrated dynamic age-dependent changes in the regulation but not the amount of HSF1
18813348 Hsf1 is required for p53 nuclear importation and activation, which implies that heat shock factors play a role in the regulation of p53.
18725048 Endotoxin tolerance and HS appear to share a common immune suppressive effect, possibly through HSF-1-mediated competitive inhibition of NF-kappaB nuclear binding.
18682744 Insight into the mechanism that regulates HSF1 turnover, and identifies the degradation of HSF1 as a target for therapeutics intervention
18657505 CoREST is bound to the hsp70 gene promoter under basal conditions and that its binding increases during heat shock response.
18474607 Hsf-1 causes specific and saturable inhibition of the transport activity of Ralbp1 and that the combination of Hsf-1 and POB1 causes nearly complete inhibition through specific bindings with Ralbp1.
18457423 the lack of a trimerization domain prevents HSF1 activation, which suggests that iHI-m noncovalent trimerization is a precondition of SS-I bond formation.
18398426 HSP70 and constitutively active HSF1 mediate protection against CDCrel-1-mediated toxicity
18286539 Two of the three putative heat shock-responsive elements (HSEs) in bag3 promoter interact with the heat shock factor (HSF) 1 in vitro and in vivo.
17922035 study shows HSF1 binds to MTA1 in vitro & in breast carcinoma; repression of estrogen-dependent transcription may contribute to role of HSF1 in cancer
17897941 HSP mRNA export escapes stress inhibition via HSF1-mediated recruitment of the nuclear pore-associating protein TPR to HSP genes, functionally connecting the first and last nuclear steps of the gene expression pathway, transcription and mRNA export.
17889646 Human cancer lines of diverse origins show much greater dependence on HSF1 function to maintain proliferation and survival than their nontransformed counterparts.
17884799 The high expression of HSF1 in gastro-intestinal cancer is associated with suppressed expression of XAF1.
17873279 activation of HSF1 and stabilization of Bcl-X(L) mediate a protective response that may contribute significantly to the cellular biology of lipid peroxidation
17622316 Activation of HSP27 is mediated through heat shock factor 1 and is counteracted by HIV-1 Vpr
17273789 IL-6, via the PI3-kinase/Akt pathway leads to inhibition of the repressive kinases MAPK/pERK and GSK3beta, and this converts inactive HSF-1 to an intermediate DNA-binding form augmenting transcriptional activation in the presence of a second stressor.
17244614 HSF1 is directly involved in the regulation of HO-1 with an anti-oxidative role
17216044 identification of genes regulated directly and indirectly by HSF1
17213196 Both HSF1 and HSF2 were able to bind the hsp70 promoter not only in response to heat shock but also during hemin-induced differentiation of K562 erythroleukemia cells.
16678833 Wild-type and constitutively active forms of HSF1 induce anticoagulation and relaxation factors in vascular endothelial cells and could therefore be used to treat cardiovascular disease.
16624816 HSP25 and HSP70i activate HSF1 and have roles in inhibition of ERK1/2 phosphorylation
16525201 Both NF-kappaB and HSF-1 are systemically activated in human acute pancreatitis. HSF-1 activation may protect against severity of pancreatitis.
16382149 HSF1 can activate MDR-1 expression in a stress-independent manner that differs from the canonical heat shock-activated mechanism involved in HSP induction.
16303760 endogenous stress pressure in cancer cells sustained the high level expression of HSF1 and subsequently suppressed XAF1 expression, implicating the synergized effect of two anti-apoptotic protein families in cytoprotection under stress circumstances
16293251 CHIP directly interacts with C-terminal deleted HSF1 but not with full-length HSF1 under non-stressed conditions, and with full-length HSF1 under heat shock treatment; interaction requires conformational change of HSF1 by heat stress.
16278218 HSF1 phosphorylation by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding
16051598 HSF1 has a strong inhibitory effect on polyglutamine aggregate formation in vivo and in vitro
15777846 Hsp90 is involved in hsp70 mRNA stabilisation and the HSF1 activation can be suppressed by high hydrostatic pressure
15760475 Phosphorylation of HSF1 residue serine326 plays a critical role in the induction of the factor's transcriptional competence by heat stress; phosphoSer326 also contributes to activation of HSF1 by chemical stress
15702990 Inactive, stress-responsive form of HSF1 accumulates in the nucleus due to a relatively potent import signal, which can be recognized by importin-alpha/beta, and simultaneously undergoes continuous nucleocytoplasmic shuttling.
15661742 phosphorylation of HSF1 by PLK1 is an essential step for HSF1 nuclear translocation by heat stress
15457556 The induction of HSF1 gene expression is associated with sporadic colon cancer.
15364926 HSF1 associates with ERK1 and 14-3-3epsilon during heat shock to modulate the amplitude of the response and lead to efficient termination of HSP expression on resumption of growth conditions
15358168 Results suggest that mutant HSF1 abolishes thermotolerance in Bcap37 cells by enhancing Jun kinase and caspase-3 pathways after hyperthermia.
15152009 HSF1 plays a functional role in cancer cells under nonstress conditions and influences cell cycle behavior and progression through mitosis and promotes the development of the aneuploid state
15081420 regulation by N-terminal truncated form of p73alpha
14960326 results suggest that ASC-2 is a novel coactivator for HSF1 and heat shock stress may contribute to the strong active transcription complex through sequential recruitment of HSF1 and ASC-2.
14766217 HSF is an important transcription factor involved in up-regulation of VDUP1 expression by stresses such as high density and serum deprivation cultures
14751250 Activation of HSP27 is mediated through heat shock factor 1 and is counteracted by HIV-1 Vpr
14707147 HSF1 regulates HSP gene expression at not one but two different steps of the expression pathway, functioning both as a transcription factor and a polyadenylation stimulatory factor
14699143 HSF1 does not have a role in transcriptional regulation of the human RANK ligand gene
12917326 HSF1 binding to 14-3-3 epsilon requires HSF1 phosphorylation on serines 303 and 307, the serine phosphorylation-dependent binding of HSF1 to 14-3-3 epsilon results in the transcriptional repression of HSF1 and its sequestration in the cytoplasm.
12878154 modified heat shock factor can suppress HIV1 promoter activity by a mechanism involving interaction with Sp1 elements in the HIV1 promoter
12813038 elevated expression of heat shock factor (HSF) 2A stimulates HSF1-induced transcription during oxidative stress in cancer cells
12665592 HSF1 is modified by SUMO-1 and SUMO-2 in a stress-inducible manner.
12659875 HSF1 activation by heat is correlated with the thermal activation of nuclear CK2 and overexpression of CK2 activates HSF1
12646186 examination of the role of the phosphorylation event in regulating SUMO-1 modification of HSF1
12468538 HSF1 contains two functional domains that mediate transcriptional repression of the c-fos and c-fms genes
11994473 Binding of the heat shock element of HSP47 by HSF1 is enhanced by TGF-beta or IL-1 beta and is augmented by a combination of both cytokines.
11877455 HSF1 granules localize to the 9q11-q12 heterochromatic region. Within this locus, HSF1 binds through direct DNA-protein interaction with a nucleosome-containing subclass of satellite III repeats.
11851405 redox-dependent thiol-disulfide exchange in regulating conformation and activity
11820785 Retrovirus-mediated transfer of dominant-negative mutant HSF1 leads to massive cell death of breast cancer cells after hyperthermia treatment.
11801594 Heat shock factor 1 represses transcription of the IL-1beta gene through physical interaction with the nuclear factor of interleukin 6

AA Sequence

MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFV      1 - 70
RQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKL     71 - 140
LTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIP    141 - 210
LMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASP    211 - 280
GGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTD    281 - 350
ARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP    351 - 420
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPV    421 - 490
LFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS                                   491 - 529
//

Text Mined References (245)

PMID Year Title
26785146 2016 Molecular mechanism of thermosensory function of human heat shock transcription factor Hsf1.
26727489 2016 Structure of human heat-shock transcription factor 1 in complex with DNA.
26511079 2015 Higher heat shock factor 1 expression in tumor stroma predicts poor prognosis in esophageal squamous cell carcinoma patients.
26504030 2015 Active Hexose-correlated Compound Down-regulates Heat Shock Factor 1, a Transcription Factor for HSP27, in Gemcitabine-resistant Human Pancreatic Cancer Cells.
26503960 2016 NEDD4-mediated HSF1 degradation underlies ?-synucleinopathy.
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
26473447 2015 The novel combination of dual mTOR inhibitor AZD2014 and pan-PIM inhibitor AZD1208 inhibits growth in acute myeloid leukemia via HSF pathway suppression.
26427350 2016 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions.
26361762 2016 Hsp70-1: upregulation via selective phosphorylation of heat shock factor 1 during coxsackieviral infection and promotion of viral replication via the AU-rich element.
26359349 2015 Heat shock factor 1, an inhibitor of non-homologous end joining repair.
26320184 2015 Adenomatous polyposis coli mutants dominantly activate Hsf1-dependent cell stress pathways through inhibition of microtubule dynamics.
26298773 2015 Tonantzitlolone cytotoxicity toward renal cancer cells is PKC?- and HSF1-dependent.
26223813 2015 Heat shock factor 1 induces cancer stem cell phenotype in breast cancer cell lines.
26193369 2015 RhoA Activation Sensitizes Cells to Proteotoxic Stimuli by Abrogating the HSF1-Dependent Heat Shock Response.
26184999 2015 Tyrosine kinase inhibitor tyrphostin AG490 triggers both apoptosis and autophagy by reducing HSF1 and Mcl-1 in PEL cells.
26159920 2015 BAG3 affects the nucleocytoplasmic shuttling of HSF1 upon heat stress.
26157141 2015 Mitochondrial Respiratory Dysfunction Induces Claudin-1 Expression via Reactive Oxygen Species-mediated Heat Shock Factor 1 Activation, Leading to Hepatoma Cell Invasiveness.
26108999 2015 Multifaceted roles of HSF1 in cancer.
26010766 2015 Glucose regulates heat shock factor 1 transcription activity via mTOR pathway in HCC cell lines.
26003728 2015 Heat shock-induced interactions among nuclear HSFs detected by fluorescence cross-correlation spectroscopy.
25982096 2015 Homocysteine facilitates LOX-1 activation and endothelial death through the PKC? and SIRT1/HSF1 mechanism: relevance to human hyperhomocysteinaemia.
25816751 2015 HSF1 transcriptional activity is modulated by IER5 and PP2A/B55.
25762445 2015 Mitochondrial SSBP1 protects cells from proteotoxic stresses by potentiating stress-induced HSF1 transcriptional activity.
25720964 2015 FBXW7 modulates cellular stress response and metastatic potential through ?HSF1 post-translational modification.
25679764 2015 MEK guards proteome stability and inhibits tumor-suppressive amyloidogenesis via HSF1.
25537516 2015 MicroRNA-135b, a HSF1 target, promotes tumor invasion and metastasis by regulating RECK and EVI5 in hepatocellular carcinoma.
25437552 2014 A direct regulatory interaction between chaperonin TRiC and stress-responsive transcription factor HSF1.
25430510 2015 HSF1 functions as a transcription regulator for Dp71 expression.
25425574 2015 Suppression of the HSF1-mediated proteotoxic stress response by the metabolic stress sensor AMPK.
25406061 2014 Modulation of the maladaptive stress response to manage diseases of protein folding.
25380824 2014 DAPK-HSF1 interaction as a positive-feedback mechanism stimulating TNF-induced apoptosis in colorectal cancer cells.
25355627 2015 Heat-induced expression of the immediate-early gene IER5 and its involvement in the proliferation of heat-shocked cells.
25324391 2014 HSF-1-mediated cytoskeletal integrity determines thermotolerance and life span.
25310819 2014 Function of Hsf1 in SV40 T?antigen?transformed HEK293T cells.
25280995 2014 Heat shock factor 1 regulates hsa-miR-432 expression in human cervical cancer cell line.
25205676 2014 HSF1 deficiency and impaired HSP90-dependent protein folding are hallmarks of aneuploid human cells.
25204655 2014 Genomic heat shock element sequences drive cooperative human heat shock factor 1 DNA binding and selectivity.
25199534 2014 Upregulation of heat shock factor 1 transcription activity is associated with hepatocellular carcinoma progression.
25199502 2014 Comparison of the molecular topologies of stress-activated transcription factors HSF1, AP-1, NRF2, and NF-?B in their induction kinetics of HMOX1.
25194503 2014 Heat shock factor 1 is required for migration and invasion of human melanoma in vitro and in vivo.
25083868 2014 The reprogramming of tumor stroma by HSF1 is a potent enabler of malignancy.
24954509 2015 HSF1 regulation of ?-catenin in mammary cancer cells through control of HuR/elavL1 expression.
24831003 2014 Identification of mixed lineage leukemia 1(MLL1) protein as a coactivator of heat shock factor 1(HSF1) protein in response to heat shock protein 90 (HSP90) inhibition.
24800749 2014 Inhibiting heat shock factor 1 in human cancer cells with a potent RNA aptamer.
24763051 2014 A gain-of-function mutant p53-HSF1 feed forward circuit governs adaptation of cancer cells to proteotoxic stress.
24726381 2014 Roles of heat shock factor 1 in neuronal response to fetal environmental risks and its relevance to brain disorders.
24619424 2014 The proteasome inhibitor bortezomib is a potent inducer of zinc finger AN1-type domain 2a gene expression: role of heat shock factor 1 (HSF1)-heat shock factor 2 (HSF2) heterocomplexes.
24581496 2014 Interplay of acetyltransferase EP300 and the proteasome system in regulating heat shock transcription factor 1.
24516381 2014 The master regulator of the cellular stress response (HSF1) is critical for orthopoxvirus infection.
24504023 2014 Dual regulation of SPI1/PU.1 transcription factor by heat shock factor 1 (HSF1) during macrophage differentiation of monocytes.
24478344 2014 HSF1 protects neurons through a novel trimerization- and HSP-independent mechanism.
24469056 2015 Akt phosphorylates and activates HSF-1 independent of heat shock, leading to Slug overexpression and epithelial-mesenchymal transition (EMT) of HER2-overexpressing breast cancer cells.
24465598 2014 Transcription regulation of HYPK by Heat Shock Factor 1.
24384723 2014 HER2/ErbB2 activates HSF1 and thereby controls HSP90 clients including MIF in HER2-overexpressing breast cancer.
24361604 2014 Heat shock transcription factor HSF1 regulates the expression of the Huntingtin-interacting protein HYPK.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256636 2013 Heat shock factor 1 over-expression protects against exposure of hydrophobic residues on mutant SOD1 and early mortality in a mouse model of amyotrophic lateral sclerosis.
24165036 2013 Overexpression of Heat Shock Transcription Factor 1 enhances the resistance of melanoma cells to doxorubicin and paclitaxel.
24130164 2014 Heat shock factor 1 accelerates hepatocellular carcinoma development by activating nuclear factor-?B/mitogen-activated protein kinase.
24126052 2013 Hyperthermia stress activates heat shock protein expression via propyl isomerase 1 regulation with heat shock factor 1.
24123326 2014 Heat shock improves Sca-1+ stem cell survival and directs ischemic cardiomyocytes toward a prosurvival phenotype via exosomal transfer: a critical role for HSF1/miR-34a/HSP70 pathway.
24002609 2013 Prognostic value of peritumoral heat-shock factor-1 in patients receiving resection of hepatocellular carcinoma.
23959860 2013 Transcriptional response to stress in the dynamic chromatin environment of cycling and mitotic cells.
23959823 2014 HSF1 and Sp1 regulate FUT4 gene expression and cell proliferation in breast cancer cells.
23902341 2013 Enhanced sensitivity of colon tumour cells to natural killer cell cytotoxicity after mild thermal stress is regulated through HSF1-mediated expression of MICA.
23869022 2013 Tight coordination of protein translation and HSF1 activation supports the anabolic malignant state.
23861773 2013 Dynamics of the full length and mutated heat shock factor 1 in human cells.
23733891 2013 Genetic selection for constitutively trimerized human HSF1 mutants identifies a role for coiled-coil motifs in DNA binding.
23587726 2013 Stress-induced transcription of regulator of G protein signaling 2 (RGS2) by heat shock transcription factor HSF1.
23587601 2013 TRAIL regulates collagen production through HSF1-dependent Hsp47 expression in activated hepatic stellate cells.
23542779 2013 Heavy metal response of the heat shock protein 70 gene is mediated by duplicated heat shock elements and heat shock factor 1.
23511056 2013 Inhibitory effect of atorvastatin on AGE-induced HCAEC apoptosis by upregulating HSF-1 protein.
23510323 2013 Heat-shock factor 1 both positively and negatively affects cellular clonogenic growth depending on p53 status.
23388456 2013 Ras-induced ROS upregulation affecting cell proliferation is connected with cell type-specific alterations of HSF1/SESN3/p21Cip1/WAF1 pathways.
23386620 2013 Heat shock factor 1 (HSF1) controls chemoresistance and autophagy through transcriptional regulation of autophagy-related protein 7 (ATG7).
23352416 2013 Englerin A stimulates PKC? to inhibit insulin signaling and to simultaneously activate HSF1: pharmacologically induced synthetic lethality.
23349863 2013 The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.
23321918 2013 A delayed antioxidant response in heat-stressed cells expressing a non-DNA binding HSF1 mutant.
23293686 2012 Poly-glutamine expanded huntingtin dramatically alters the genome wide binding of HSF1.
23264262 2013 Cell-type-dependent access of HSF1 and HSF4 to ?B-crystallin promoter during heat shock.
23252346 2013 The heat shock transcription factor 1 as a potential new therapeutic target in multiple myeloma.
23192351 2013 Forkhead box M1 is regulated by heat shock factor 1 and promotes glioma cells survival under heat shock stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180277 2013 Expression of taurine transporter (TauT) is modulated by heat shock factor 1 (HSF1) in motor neurons of ALS.
23121022 2013 Over-expression of heat shock factor 1 phenocopies the effect of chronic inhibition of TOR by rapamycin and is sufficient to ameliorate Alzheimer's-like deficits in mice modeling the disease.
22981541 2012 Transcriptional regulation of human novel gene SPATA12 promoter by AP-1 and HSF.
22945628 2012 Loss of tumor suppressor NF1 activates HSF1 to promote carcinogenesis.
22940245 2012 RPA assists HSF1 access to nucleosomal DNA by recruiting histone chaperone FACT.
22863008 2012 HSF1 drives a transcriptional program distinct from heat shock to support highly malignant human cancers.
22768106 2012 mTOR is essential for the proteotoxic stress response, HSF1 activation and heat shock protein synthesis.
22510478 2012 The heat shock transcription factor Hsf1 is downregulated in DNA damage-associated senescence, contributing to the maintenance of senescence phenotype.
22443056 2012 [Protection of HSF1/HSP70 pathway on UVA-induced HaCaT cells apoptosis via inhibiting the activation of c-Jun N-terminal kinase].
22347460 2012 Regulation of cyclooxygenase-2 expression by heat: a novel aspect of heat shock factor 1 function in human cells.
22266185 2012 Targeting heat shock factor 1 with a triazole nucleoside analog to elicit potent anticancer activity on drug-resistant pancreatic cancer.
22042860 2011 High levels of nuclear heat-shock factor 1 (HSF1) are associated with poor prognosis in breast cancer.
22018489 2011 Heat shock factor 1 upregulates transcription of Epstein-Barr Virus nuclear antigen 1 by binding to a heat shock element within the BamHI-Q promoter.
22009757 2012 Heat shock factor 1 promotes invasion and metastasis of hepatocellular carcinoma in vitro and in vivo.
21883218 2011 Dual neuroprotective pathways of a pro-electrophilic compound via HSF-1-activated heat-shock proteins and Nrf2-activated phase 2 antioxidant response enzymes.
21879256 2012 State of heat shock factor 1 expression as a putative diagnostic marker for oral squamous cell carcinoma.
21784850 2011 Promotion of heat shock factor Hsf1 degradation via adaptor protein filamin A-interacting protein 1-like (FILIP-1L).
21597468 2011 Transformation of eEF1B? into heat-shock response transcription factor by alternative splicing.
21557666 2011 Loss of HSF1 results in defective radiation-induced G(2) arrest and DNA repair.
21480956 2011 Expression of heat shock proteins in classical Hodgkin lymphoma: correlation with apoptotic pathways and prognostic significance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21361146 2010 Human hepatoma cell line (HepG2) cellular response to hypothermic stress with recovery. Induction of Hsp70, Hsp60 and Hsf1 expression.
21353370 2011 HSP70-mediated control of endothelial cell apoptosis during pre-eclampsia.
21330448 2011 Prosurvival role of heat shock factor 1 in the pathogenesis of pancreatobiliary tumors.
21299508 2011 Over expression of HSP70 and HSF1 in endothelial cells during pre-eclamptic placental stress.
21266308 2011 Distinct, gene-specific effect of heat shock on heat shock factor-1 recruitment and gene expression of CXC chemokine genes.
21253609 2011 Deciphering human heat shock transcription factor 1 regulation via post-translational modification in yeast.
21155232 2009 [Effects of human HSF1 on transcriptional regulation of prohibitin promoter].
21098017 2011 Neuroprotective drug riluzole amplifies the heat shock factor 1 (HSF1)- and glutamate transporter 1 (GLT1)-dependent cytoprotective mechanisms for neuronal survival.
21085490 2010 Protein kinase A binds and activates heat shock factor 1.
21078672 2011 KRIBB11 inhibits HSP70 synthesis through inhibition of heat shock factor 1 function by impairing the recruitment of positive transcription elongation factor b to the hsp70 promoter.
21044828 2010 Silencing HSF1 by short hairpin RNA decreases cell proliferation and enhances sensitivity to hyperthermia in human melanoma cell lines.
20941531 2011 Heat shock transcription factor-1 inhibits H2O2-induced apoptosis via down-regulation of reactive oxygen species in cardiac myocytes.
20834230 2010 Heat shock factor 1 ameliorates proteotoxicity in cooperation with the transcription factor NFAT.
20802198 2010 Heat shock transcription factor 1 localizes to sex chromatin during meiotic repression.
20630999 2010 Involvement of RAGE, NADPH oxidase, and Ras/Raf-1 pathway in glycated LDL-induced expression of heat shock factor-1 and plasminogen activator inhibitor-1 in vascular endothelial cells.
20459615 2010 HSF1 overexpression enhances oncolytic effect of replicative adenovirus.
20396959 2010 Heat shock factor 1 is a transcription factor of Fas gene.
20198330 2010 The antitumor effect of PLK1 and HSF1 double knockdown on human oral carcinoma cells.
20185824 2010 AIRAP, a new human heat shock gene regulated by heat shock factor 1.
20176657 2010 Arylamine N-acetyltransferase 1 gene regulation by androgens requires a conserved heat shock element for heat shock factor-1.
20152833 2010 Heat shock factor 1 binds to and transcribes satellite II and III sequences at several pericentromeric regions in heat-shocked cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19844581 2009 Converting redox signaling to apoptotic activities by stress-responsive regulators HSF1 and NRF2 in fenretinide treated cancer cells.
19817876 2009 Deficit of heat shock transcription factor 1-heat shock 70 kDa protein 1A axis determines the cell death vulnerability in a model of spinocerebellar ataxia type 6.
19793920 2009 Heat-shock factor 1 controls genome-wide acetylation in heat-shocked cells.
19758120 2009 Mutational analysis of human heat-shock transcription factor 1 reveals a regulatory role for oligomerization in DNA-binding specificity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19668225 2009 Upregulation of lactate dehydrogenase A by ErbB2 through heat shock factor 1 promotes breast cancer cell glycolysis and growth.
19609719 2010 Dominant-positive HSF1 decreases alpha-synuclein level and alpha-synuclein-induced toxicity.
19597476 2009 Heat shock protein 27 is involved in SUMO-2/3 modification of heat shock factor 1 and thereby modulates the transcription factor activity.
19517141 2009 Disc cell clusters in pathological human intervertebral discs are associated with increased stress protein immunostaining.
19486883 2009 Alpha-helix 1 in the DNA-binding domain of heat shock factor 1 regulates its heat-induced trimerization and DNA-binding.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401454 2009 Involvement of NADPH oxidase in oxidized LDL-induced upregulation of heat shock factor-1 and plasminogen activator inhibitor-1 in vascular endothelial cells.
19338268 2009 Aromatic-participant interactions are essential for disulfide-bond-based trimerization in human heat shock transcription factor 1.
19335068 2009 Inhibiting the transcription factor HSF1 as an anticancer strategy.
19229036 2009 Stress-inducible regulation of heat shock factor 1 by the deacetylase SIRT1.
19221897 2009 Hyperthermia in the febrile range induces HSP72 expression proportional to exposure temperature but not to HSF-1 DNA-binding activity in human lung epithelial A549 cells.
19129477 2009 Heterotrimerization of heat-shock factors 1 and 2 provides a transcriptional switch in response to distinct stimuli.
19097133 2009 Aberrant regulation and modification of heat shock factor 1 in senescent human diploid fibroblasts.
18813348 2008 Hsf1 is required for the nuclear translocation of p53 tumor suppressor.
18757733 2008 Heat shock factor 1 regulates lifespan as distinct from disease onset in prion disease.
18725048 2008 Heat shock factor 1 inhibits nuclear factor-kappaB nuclear binding activity during endotoxin tolerance and heat shock.
18682744 2008 Riluzole increases the amount of latent HSF1 for an amplified heat shock response and cytoprotection.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18657505 2008 CoREST represses the heat shock response mediated by HSF1.
18474607 2008 Hsf-1 and POB1 induce drug sensitivity and apoptosis by inhibiting Ralbp1.
18457423 2008 Two distinct disulfide bonds formed in human heat shock transcription factor 1 act in opposition to regulate its DNA binding activity.
18398426 2008 HSP70 and constitutively active HSF1 mediate protection against CDCrel-1-mediated toxicity.
18286539 2008 Bag3 gene expression is regulated by heat shock factor 1.
18245447 2008 Differential display of DNA-binding proteins reveals heat-shock factor 1 as a circadian transcription factor.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17922035 2008 Heat shock factor 1 represses estrogen-dependent transcription through association with MTA1.
17897941 2007 HSF1-TPR interaction facilitates export of stress-induced HSP70 mRNA.
17889646 2007 Heat shock factor 1 is a powerful multifaceted modifier of carcinogenesis.
17884799 2007 [Expression of HSF1 and XAF1 in gastro-intestinal cancer].
17873279 2007 Heat shock factor 1 attenuates 4-Hydroxynonenal-mediated apoptosis: critical role for heat shock protein 70 induction and stabilization of Bcl-XL.
17467953 2007 Nine-amino-acid transactivation domain: establishment and prediction utilities.
17273789 2007 De-repression of heat shock transcription factor-1 in interleukin-6- treated hepatocytes is mediated by downregulation of glycogen synthase kinase 3beta and MAPK/ERK-1.
17244614 2007 Cadmium-responsive element of the human heme oxygenase-1 gene mediates heat shock factor 1-dependent transcriptional activation.
17216044 2006 Genome-wide analysis of human HSF1 signaling reveals a transcriptional program linked to cellular adaptation and survival.
17213196 2007 Heat shock factor 2 (HSF2) contributes to inducible expression of hsp genes through interplay with HSF1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16678833 2007 HSF1 and constitutively active HSF1 improve vascular endothelial function (heat shock proteins improve vascular endothelial function).
16624816 2006 Heat shock protein 25 or inducible heat shock protein 70 activates heat shock factor 1: dephosphorylation on serine 307 through inhibition of ERK1/2 phosphorylation.
16525201 2006 Heat shock factor-1 and nuclear factor-kappaB are systemically activated in human acute pancreatitis.
16428449 2006 Inhibition of DNA binding by differential sumoylation of heat shock factors.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16382149 2006 Heat shock-independent induction of multidrug resistance by heat shock factor 1.
16371476 2006 PDSM, a motif for phosphorylation-dependent SUMO modification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303760 2006 HSF1 down-regulates XAF1 through transcriptional regulation.
16293251 2005 CHIP interacts with heat shock factor 1 during heat stress.
16278218 2006 Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding.
16051598 2005 Active HSF1 significantly suppresses polyglutamine aggregate formation in cellular and mouse models.
15777846 2005 Hsp90 inhibitor geldanamycin increases hsp70 mRNA stabilisation but fails to activate HSF1 in cells exposed to hydrostatic pressure.
15760475 2005 Analysis of phosphorylation of human heat shock factor 1 in cells experiencing a stress.
15702990 2005 Constitutive nuclear import and stress-regulated nucleocytoplasmic shuttling of mammalian heat-shock factor 1.
15661742 2005 Polo-like kinase 1 phosphorylates heat shock transcription factor 1 and mediates its nuclear translocation during heat stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15457556 2004 Induction of HSF1 expression is associated with sporadic colorectal cancer.
15364926 2004 Interactions between extracellular signal-regulated protein kinase 1, 14-3-3epsilon, and heat shock factor 1 during stress.
15358168 2004 HSF1 blockade-induced tumor thermotolerance abolishment is mediated by JNK-dependent caspase-3 activation.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15152009 2004 Expression of a dominant negative heat shock factor-1 construct inhibits aneuploidy in prostate carcinoma cells.
15081420 2004 Regulation of HSF1-responsive gene expression by N-terminal truncated form of p73alpha.
14960326 2004 Coactivator ASC-2 mediates heat shock factor 1-mediated transactivation dependent on heat shock.
14766217 2004 Heat shock factor regulates VDUP1 gene expression.
14707147 2004 HSF1 modulation of Hsp70 mRNA polyadenylation via interaction with symplekin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699143 2004 Functional role for heat shock factors in the transcriptional regulation of human RANK ligand gene expression in stromal/osteoblast cells.
14623809 2003 Heat shock transcription factor 1 protects cardiomyocytes from ischemia/reperfusion injury.
12917326 2003 Regulation of molecular chaperone gene transcription involves the serine phosphorylation, 14-3-3 epsilon binding, and cytoplasmic sequestration of heat shock factor 1.
12878154 2003 Regulation of the HIV1 long terminal repeat by mutant heat shock factor.
12865437 2003 Formation of nuclear stress granules involves HSF2 and coincides with the nucleolar localization of Hsp70.
12813038 2003 Elevated expression of heat shock factor (HSF) 2A stimulates HSF1-induced transcription during stress.
12665592 2003 Phosphorylation of serine 303 is a prerequisite for the stress-inducible SUMO modification of heat shock factor 1.
12659875 2003 Transcriptional activity and DNA binding of heat shock factor-1 involve phosphorylation on threonine 142 by CK2.
12646186 2003 Insights into the regulation of heat shock transcription factor 1 SUMO-1 modification.
12621024 2003 HSF-1 interacts with Ral-binding protein 1 in a stress-responsive, multiprotein complex with HSP90 in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468538 2003 Heat shock factor 1 contains two functional domains that mediate transcriptional repression of the c-fos and c-fms genes.
11994473 2002 Induction of heat shock protein 47 synthesis by TGF-beta and IL-1 beta via enhancement of the heat shock element binding activity of heat shock transcription factor 1.
11801594 2002 Heat shock factor 1 represses transcription of the IL-1beta gene through physical interaction with the nuclear factor of interleukin 6.
11583998 2001 Evidence for a mechanism of repression of heat shock factor 1 transcriptional activity by a multichaperone complex.
11527157 2001 JNK phosphorylates the HSF1 transcriptional activation domain: role of JNK in the regulation of the heat shock response.
11514557 2001 Regulation of heat shock transcription factor 1 by stress-induced SUMO-1 modification.
11486022 2001 Transcriptional activation domains of human heat shock factor 1 recruit human SWI/SNF.
11447121 2001 Phosphorylation of serine 230 promotes inducible transcriptional activity of heat shock factor 1.
11162511 2001 Repression of the HSP70B promoter by NFIL6, Ku70, and MAPK involves three complementary mechanisms.
11005381 2000 Potential targets for HSF1 within the preinitiation complex.
10867642 2000 Activation of heat shock factor 1 by hyperosmotic or hypo-osmotic stress is drastically attenuated in normal human fibroblasts during senescence.
10821850 2000 Divergent hTAFII31-binding motifs hidden in activation domains.
10747973 2000 c-Jun NH2-terminal kinase targeting and phosphorylation of heat shock factor-1 suppress its transcriptional activity.
10561509 1999 Transcriptional activation of mouse cytosolic chaperonin CCT subunit genes by heat shock factors HSF1 and HSF2.
10413683 1999 Human heat shock factor 1 is predominantly a nuclear protein before and after heat stress.
10359787 1999 Rapid and reversible relocalization of heat shock factor 1 within seconds to nuclear stress granules.
9880553 1999 Signal transducer and activator of transcription-1 and heat shock factor-1 interact and activate the transcription of the Hsp-70 and Hsp-90beta gene promoters.
9727490 1998 Repression of heat shock transcription factor HSF1 activation by HSP90 (HSP90 complex) that forms a stress-sensitive complex with HSF1.
9699716 1998 Heat shock transcription factor-1 regulates heat shock protein-72 expression in human keratinocytes exposed to ultraviolet B light.
9649501 1998 Negative regulation of the heat shock transcriptional response by HSBP1.
9535852 1998 Transcriptional activation of heat shock factor HSF1 probed by phosphopeptide analysis of factor 32P-labeled in vivo.
9499401 1998 Molecular chaperones as HSF1-specific transcriptional repressors.
9359875 1997 HSF1 granules: a novel stress-induced nuclear compartment of human cells.
9341107 1997 Heat shock factor 1 represses Ras-induced transcriptional activation of the c-fos gene.
9325337 1997 Heat shock transcription factor 1 binds selectively in vitro to Ku protein and the catalytic subunit of the DNA-dependent protein kinase.
9222609 1996 A pathway of multi-chaperone interactions common to diverse regulatory proteins: estrogen receptor, Fes tyrosine kinase, heat shock transcription factor Hsf1, and the aryl hydrocarbon receptor.
9121459 1997 Repression of the heat shock factor 1 transcriptional activation domain is modulated by constitutive phosphorylation.
8946918 1996 Repression of human heat shock factor 1 activity at control temperature by phosphorylation.
8940068 1996 Sequential phosphorylation by mitogen-activated protein kinase and glycogen synthase kinase 3 represses transcriptional activation by heat shock factor-1.
8926278 1996 Transcriptional repression of the prointerleukin 1beta gene by heat shock factor 1.
8856972 1996 Sensing stress and responding to stress.
8455624 1993 Activation of human heat shock genes is accompanied by oligomerization, modification, and rapid translocation of heat shock transcription factor HSF1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7935471 1994 Activation of the DNA-binding ability of human heat shock transcription factor 1 may involve the transition from an intramolecular to an intermolecular triple-stranded coiled-coil structure.
7760831 1995 A heat shock-responsive domain of human HSF1 that regulates transcription activation domain function.
7639722 1995 Heat shock factor-1 and the heat shock cognate 70 protein associate in high molecular weight complexes in the cytoplasm of NIH-3T3 cells.
1871106 1991 Isolation of a cDNA for HSF2: evidence for two heat shock factor genes in humans.
1871105 1991 Molecular cloning and expression of a human heat shock factor, HSF1.
1628823 1992 The human heat shock protein hsp70 interacts with HSF, the transcription factor that regulates heat shock gene expression.