Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.39
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
interstitial lung disease -1.100 7.7e-03
osteosarcoma -2.039 1.6e-06
posterior fossa group B ependymoma 1.400 6.6e-05
group 4 medulloblastoma -2.200 6.1e-08
medulloblastoma, large-cell -1.700 1.7e-04
hereditary spastic paraplegia -1.352 1.0e-02
tuberculosis 1.700 3.0e-04
pancreatic ductal adenocarcinoma liver m... -2.238 1.0e-03
non-small cell lung cancer -1.396 1.3e-21
lung cancer -2.000 2.1e-03
fibroadenoma -1.300 2.0e-02
interstitial cystitis -1.500 1.1e-03
lung adenocarcinoma -1.200 2.4e-11
aldosterone-producing adenoma -1.239 3.7e-02
subependymal giant cell astrocytoma 1.512 2.4e-02
ductal carcinoma in situ -1.900 5.5e-04
invasive ductal carcinoma -2.100 1.1e-02
ulcerative colitis -1.600 2.1e-04
ovarian cancer -2.200 3.5e-07
Down syndrome 1.200 6.6e-04

Gene RIF (3)

PMID Text
22082156 Knockdown of hydroxysteroid dehydrogenase like 2 (HSDL2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20877624 Observational study of gene-disease association. (HuGE Navigator)
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALP      1 - 70
CIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYL     71 - 140
KKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLG    141 - 210
GPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEA    211 - 280
VSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLK    281 - 350
SKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL      351 - 418
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
19946888 2010 Defining the membrane proteome of NK cells.
19703561 2009 In search for function of two human orphan SDR enzymes: hydroxysteroid dehydrogenase like 2 (HSDL2) and short-chain dehydrogenase/reductase-orphan (SDR-O).
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18369455 2008 Transcriptional profiling uncovers a network of cholesterol-responsive atherosclerosis target genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16501878 2006 Fusion and fission, the evolution of sterol carrier protein-2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12834046 2003 Molecular cloning and characterization of a novel human hydroxysteroid dehydrogenase-like 2 (HSDL2) cDNA from fetal brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.