Property Summary

Ligand Count 1
NCBI Gene PubMed Count 94
PubMed Score 109.16
PubTator Score 86.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Hypercortisolism 8
Disease Target Count P-value
psoriasis 6694 5.1e-08
ulcerative colitis 1819 7.4e-05
adrenocortical carcinoma 1428 3.7e-03
colon cancer 1478 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hyperandrogenism 34 3.773 1.9
Prostate cancer 175 3.007 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -3.439 3.7e-03
colon cancer -2.500 1.3e-02
psoriasis -1.800 5.1e-08
ulcerative colitis -2.100 7.4e-05

 GWAS Trait (1)

Gene RIF (66)

AA Sequence

MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKR      1 - 70
ACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNG     71 - 140
HEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGI    141 - 210
LSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLD    211 - 280
SRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQ    281 - 350
KTVEWVGSLVDRHKETLKSKTQ                                                    351 - 372
//

Text Mined References (97)

PMID Year Title