Property Summary

NCBI Gene PubMed Count 27
PubMed Score 39.85
PubTator Score 18.28

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (13)

AA Sequence

MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHA      1 - 70
AFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQ     71 - 140
ALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV    141 - 210
PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM                       211 - 261
//

Text Mined References (30)

PMID Year Title