Property Summary

NCBI Gene PubMed Count 20
PubMed Score 1098.84
PubTator Score 313.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.100 2.9e-02
ependymoma -3.100 7.8e-03
glioblastoma -2.200 3.5e-04
medulloblastoma -3.300 7.2e-10
atypical teratoid / rhabdoid tumor -3.000 1.1e-07
medulloblastoma, large-cell -3.100 3.2e-05
primitive neuroectodermal tumor -2.100 3.9e-04
pancreatic ductal adenocarcinoma liver m... -3.448 1.9e-02
non-small cell lung cancer -3.390 2.2e-25
lung cancer -5.000 2.7e-07
colon cancer -1.600 3.4e-04
pancreatic cancer 1.600 3.2e-04
fibroadenoma 1.100 2.6e-03
lung adenocarcinoma -3.400 1.7e-11
pediatric high grade glioma -1.900 1.5e-06
pilocytic astrocytoma -2.400 1.3e-06
subependymal giant cell astrocytoma -1.925 1.2e-02
invasive ductal carcinoma 2.100 2.6e-03
lung carcinoma -4.100 2.3e-23
Breast cancer 1.800 4.8e-11
ductal carcinoma in situ 1.600 1.1e-03
ovarian cancer -5.200 1.1e-17

Gene RIF (11)

PMID Text
25422294 No significant difference was found in genotype or allele distributions of the polymorphisms rs12529 of HSD17B5 and rs898611 of HSD17B6 between patients with PCOS and controls.
24244276 the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower.
22114194 17beta-hydroxysteroid dehydrogenase type 6 (17betaHSD6) converts the androgen DHT to the estrogen 3beta-Adiol, and this leads to activation of the ERbeta reporter.
21039282 data suggest that there is no association of HSD17B6 and HSD17B5 variants with the occurrence of polycystic ovary syndrome in the Chinese population
21039282 Observational study of gene-disease association. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
19837928 These replication data suggest a role for HSD17B6 in polycystic ovary syndrome
19837928 Observational study of gene-disease association. (HuGE Navigator)
17289849 RoDH enzymes are expressed in tissues that have microsomal 3alpha-hydroxysteroid dehydrogenase/epimerase activities
17070195 Observational study of gene-disease association. (HuGE Navigator)
17070195 These data suggest that polymorphisms in the HSD17B6 gene are associated with PCOS and key clinical phenotypes of the disorder.

AA Sequence

MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR      1 - 70
GQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG     71 - 140
VIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFR    141 - 210
TGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR    211 - 280
YSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV                                     281 - 317
//

Text Mined References (22)

PMID Year Title
25422294 2015 Association analysis between the polymorphisms of HSD17B5 and HSD17B6 and risk of polycystic ovary syndrome in Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
22114194 2011 Estrogen receptor ? and 17?-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer.
21039282 2010 Polymorphisms of the HSD17B6 and HSD17B5 genes in Chinese women with polycystic ovary syndrome.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
19837928 2009 Independent confirmation of association between metabolic phenotypes of polycystic ovary syndrome and variation in the type 6 17beta-hydroxysteroid dehydrogenase gene.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17289849 2007 Role of microsomal retinol/sterol dehydrogenase-like short-chain dehydrogenases/reductases in the oxidation and epimerization of 3alpha-hydroxysteroids in human tissues.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17070195 2006 Polymorphism in HSD17B6 is associated with key features of polycystic ovary syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11513953 2001 Gene structure, chromosomal localization and analysis of 3-ketosteroid reductase activity of the human 3(alpha-->beta)-hydroxysteroid epimerase.
11360992 2001 Further characterization of human microsomal 3alpha-hydroxysteroid dehydrogenase.
11306067 2001 Cloning of the human RoDH-related short chain dehydrogenase gene and analysis of its structure.
11165032 2001 Evolution of 17beta-hydroxysteroid dehydrogenases and their role in androgen, estrogen and retinoid action.
10896656 2000 Molecular characterization of a first human 3(alpha-->beta)-hydroxysteroid epimerase.
9188497 1997 Expression cloning and characterization of oxidative 17beta- and 3alpha-hydroxysteroid dehydrogenases from rat and human prostate.