Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.84
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.668 4.2e-03
Multiple myeloma 1.370 2.4e-03
malignant mesothelioma -2.100 3.0e-07
Barrett's esophagus 2.100 3.1e-02
esophageal adenocarcinoma 2.600 1.8e-02
cystic fibrosis 1.182 3.9e-05
glioblastoma 1.400 1.3e-02
atypical teratoid/rhabdoid tumor 1.400 1.3e-05
Duchenne muscular dystrophy 1.360 1.4e-06
non-small cell lung cancer -1.350 9.0e-19
lung cancer -1.600 4.2e-05
breast carcinoma -1.500 1.3e-04
fibroadenoma -1.200 2.7e-02
sonic hedgehog group medulloblastoma 1.600 7.3e-06
primary Sjogren syndrome 1.300 7.2e-03
lung adenocarcinoma -1.600 4.2e-09
lung carcinoma -2.200 3.5e-23
ulcerative colitis -1.500 5.7e-09
ovarian cancer -3.000 4.4e-11
dermatomyositis 1.100 2.2e-03

Synonym

Accession Q8NBQ5 Q96HF6 Q9UKU4
Symbols DHRS8
PAN1B
RETSDR2
SDR16C2
17BHSD11
17-BETA-HSD11
17-BETA-HSDXI

Gene

PANTHER Protein Class (2)

PDB

1YB1  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
26472732 knowledge of its in vitro activity together with a newly described expression pattern at the protein level in tissues involved in steroidogenesis and detoxification could suggest a potential role of DHRS8 in vivo
21549806 hydroxysteroid (17-beta) dehydrogenase 11 transcription in prostate cancer cells is regulated by Sp1 transcription factor and C-EBP alpha
19469652 Increased Pan1b is associated with prostate cancer of seminal vesicle invasion.
18804447 Mutation analyses suggest that the PAT-like motif in 17betaHSD11 will not be functionally similar to the canonical PAT motif.
12697717 Role for 17-beta-HSDXI in androgen metabolism during steroidogenesis.

AA Sequence

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK      1 - 70
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT     71 - 140
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG    141 - 210
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV    211 - 280
LKQKISVKFDAVIGYKMKAQ                                                      281 - 300
//

Text Mined References (22)

PMID Year Title
26472732 2016 Human dehydrogenase/reductase (SDR family) member 8 (DHRS8): a description and evaluation of its biochemical properties.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
21549806 2011 Transcriptional regulation of type 11 17?-hydroxysteroid dehydrogenase expression in prostate cancer cells.
21269460 2011 Initial characterization of the human central proteome.
19469652 2009 17beta-hydroxysteroid dehydrogenase type 11 (Pan1b) expression in human prostate cancer.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18804447 2008 Identification and characterization of the ER/lipid droplet-targeting sequence in 17beta-hydroxysteroid dehydrogenase type 11.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14996095 2004 SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma.
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12697717 2003 17 beta-hydroxysteroid dehydrogenase type XI localizes to human steroidogenic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11165019 2001 Pan1b (17betaHSD11)-enzymatic activity and distribution in the lung.
10800688 2000 Short-chain dehydrogenases/reductases in retina.
9888557 Cloning and expression of a novel tissue specific 17beta-hydroxysteroid dehydrogenase.