Property Summary

NCBI Gene PubMed Count 210
PubMed Score 850.27
PubTator Score 309.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Peptic ulcer 22
Ulcer of esophagus 1

Expression

  Differential Expression (28)

Disease log2 FC p
Obesity 1.100 3.3e-02
malignant mesothelioma -8.000 3.7e-10
astrocytic glioma -1.600 2.1e-02
ependymoma -1.700 3.2e-02
psoriasis -2.800 1.0e-06
osteosarcoma -1.490 3.1e-03
Atopic dermatitis -3.400 1.1e-05
adrenocortical adenoma -1.172 3.2e-03
adrenocortical carcinoma -1.578 1.6e-06
pancreatic ductal adenocarcinoma liver m... -2.777 3.6e-02
non-small cell lung cancer -1.012 8.3e-06
intraductal papillary-mucinous adenoma (... -1.600 1.8e-02
intraductal papillary-mucinous carcinoma... -2.100 6.7e-03
intraductal papillary-mucinous neoplasm ... -1.900 4.9e-02
lung cancer -1.800 1.6e-03
sarcoidosis 1.700 4.6e-02
breast carcinoma -1.500 8.0e-03
fibroadenoma -2.800 1.3e-02
interstitial cystitis 2.400 2.4e-03
lung adenocarcinoma -2.100 5.3e-12
Pick disease -1.100 1.7e-02
gastric carcinoma 1.800 1.4e-02
ductal carcinoma in situ -1.500 1.2e-02
ulcerative colitis 1.300 1.9e-03
ovarian cancer -1.400 1.9e-07
pituitary cancer -2.500 1.2e-05
pancreatic cancer 1.200 9.7e-03
head and neck cancer and chronic obstruc... 1.500 5.0e-03

Protein-protein Interaction (4)

Gene RIF (201)

PMID Text
26671915 ins4436A in the HSD11B1 gene is associated with essential hypertension in a Polish population
26528718 the availability of H6PDH determines the different direction of 11beta-HSD1 in liver and Leydig cells.
26452272 we also found a significant difference between AA and AG genotype of rs6688832 and the AG genotype was associated with hyperandrogenism, but no statistical different distribution of polymorphism rs17368528 of H6PD and rs846908 of HSD11B1 were observed
26163245 11beta-HSD1 expressed in polyp-derived epithelial cells may be involved in the anti-inflammatory function of glucocorticoid in the treatment of nasal polyps, which contributes to increased levels of endogenous cortisol.
25989394 Skeletal muscle 11beta-HSD1 is up-regulated with age in women and is associated with reduced grip strength, insulin resistance, and an adverse body composition profile.
25788665 Our work is one of the first comprehensive views of DNA methylation and expression in the placenta for both HSD11B types 1 and 2, linking epigenetic alterations with the regulation of fetal stress and birth weight outcomes.
25751397 Our results indicate that HSD11B1 polymorphisms may contribute toward the development of MetS in psychiatric patients treated with potential weight gain-inducing psychotropic drugs, but do not play a significant role in the general population
25666420 Glucocorticoids and 11beta-hydroxysteroid dehydrogenases: mechanisms for hypertension
25659145 Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11betaHSD1.
25436731 This review describes the body of work performed over the past decade detailing the importance and regulation of HSD11B1 in humans, and its relevance to metabolic disease. [review]
25393644 Although cerebral 11betaHSD1 reductase activity may be greater in cognitively impaired patients, in healthy men any contribution of 11betaHSD1 in the brain to systemic cortisol/cortisone turnover is negligible.
24969481 Promoter SNPs of the HSD11B1 gene might exert a potential genetic protective role against the development of PCOS, possibly via their beneficial effect on carbohydrate homeostasis due to facilitation of insulin efflux from pancreatic beta-cells.
24915124 Polymorphisms in the 11betaHSD1 and NR3C1 genes were associated with impaired cognitive function in Cushings syndrome.
24810847 These results indicate that chronic rhinosinusitis -relevant cytokines can modulate the expression of 11beta-HSD1, 11beta-HSD2, and CYP11B1 in the sinus mucosa, resulting in increasing intracellular concentrations of bioactive glucocorticoids.
24729284 The polymorphism of HSD11B1 may be a cause of childhood obesity, or even associated with the complication of childhood obesity.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1) in primary human brain microvascular endothelial cells
24447082 The expression levels of 11beta-HSD1, CYP11B1, and cortisol were up-regulated in mild and moderate/severe persistent allergic nasal mucosa.
24391882 Increased skeletal muscle 11betaHSD1 mRNA is associated with lower muscle strength in aging.
24285685 Genetic variations in HSD11B1 may affect the physiological cortisol levels and the severity of age-related osteoporosis.
24243637 Increased proinflammatory signaling in inflamed adipose tissue may mediate elevated 11beta-HSD1 expression at this site via MEK, C/EBPbeta, and NF-kappaB/RelA.
24149070 Two critical enzymes 11beta-HSD1 and 11beta-HSD2 that regulate glucocorticoid activities are expressed inversely in malignant hepatocytes, resulting in the inactivation of endogenous glucocorticoids and the loss of gluconeogenesis.
24147632 placental gene expression of 11bHSD-1 may be indirectly connected with infantile growth via adiponectin-associated metabolic regulation represented by adiponectin levels in umbilical cord blood.
24122936 Development of specific inhibitors targeting 11beta-HSD1 might be a promising way to improve impaired insulin-stimulated glucose uptake.
24086653 Pro-inflammatory cytokine induction of 11beta-hydroxysteroid dehydrogenase type 1 in A549 cells requires phosphorylation of C/EBPbeta at Thr235.
24061267 A variant (rs932335) in the HSD11B1 gene is associated with colorectal cancer.
24055708 regulation of cytosolic cortisol concentrations by 11beta-HSD1 appears to modulate expression of inflammatory cytokines in normal human epidermal keratinocytes
24054540 Data suggest that HSD11B1 expression and activity in fetal membranes during prolonged pregnancy are similar in women who enter labor spontaneously or who respond to labor induction; HSD11B1 expression and activity are low in non-responders.
23979790 The aim of the work was to investigate the expression of HSD11B1, HSD11B2, H6PDH, and glucocorticoids receptor (GR) mRNA in subcutaneous adipose tissue (SAT) from obese women with or without polycystic ovary syndrome.
23874920 Intracellular glucocorticoid levels mediated by 11beta-HSD1 may be involved in the mechanism that exacerbates ischemic neuronal cell death; thus inhibiting this enzyme could have potential neuroprotective value.
23869418 in a South Indian population, a polymorphism of the HSD11B1 gene containing the single-nucleotide polymorphism (SNP) rs12086634 T-->G may have a role in metabolic syndrome
23836520 In African Americans, but not Hispanics, subcutaneous adipose tissue 11betaHSD1 is associated with insulin sensitivity and disposition index, and might be mediated by hepatic fat fraction.
23778418 This study is the first to demonstrate the possible influence of the HSD11B1-rs12086634 polymorphism in tumor size.
23722901 Elevated 11beta-HSD1 activity in aging skin leads to increased local glucocorticoid generation, which may account for adverse changes occurring in the elderly.
23701286 Data suggest that males exhibit higher HSD11B1 activity in cultured adipocytes than females; no such difference was observed in biopsy samples of subcutaneous adipose tissue; HSD11B1 expression correlates with insulin resistance and adiposity.
23678035 Ovarian 11beta-hydroxysteroid dehydrogenase (11betaHSD) activity is suppressed in women with anovulatory polycystic ovary syndrome.
23659736 rs846910 in the HSD11B1 gene could be a marker for hypertensive disorders during pregnancy.
23612224 Data suggest that HSD11B1 activity is involved in various endocrine disease states and plays roles in the physiology and pathologies of various endocrine glands and other tissues. [REVIEW]
23375992 HSD11B1 polymorphisms (rs12086634 and rs1000283) are associated with elevated levels of alanine aminotransferase in Koreans.
23362866 11beta-HSD1 expression was decreased in all seborrheic keratosis, squamous cell carcinoma, and basal cell carcinoma lesions compared with unaffected skin.
23190557 in adipose tissue, estrogen receptor beta-mediated estrogen signaling can up-regulate 11 beta-Hydroxysteroid dehydrogenase type I and that this may be of particular importance in postmenopausal women
23090578 CBX treatment inhibited the stimulatory effects of BPA (at 10 nM) on PPAR-gamma and LPL mRNA expression, whereas RU486 inhibited 11beta-HSD1 mRNA expression in the adipocytes.
23017470 Using a dual luciferase reporter assay, we identified three potential miRNAs, hsa-miR-340, -561 and -579, as potential negative regulators of HSD11B1 expression.
23009206 Report increased expression of 11beta-HSD-1 and glucocorticoid receptor in obese coronary artery disease patients.
23007990 There is tissue-specific expression of 11beta-HSD-1 in metabolic syndrome and associated cardiovascular disorders.
22986073 rs4844880 polymorphism in the promoter region of the HSD11B1 gene resulting in a reduced expression of the enzyme may exert a beneficial effect on bone in healthy and postmenopausal osteoporotic women
22719058 Expression of 11beta-hydroxysteroid dehydrogenase enzymes in human osteosarcoma.
22445027 Common polymorphisms at POR, SULT2A1 or HSD11B1 were not associated with PA in a Finnish Caucasian population.
22384521 11beta-hydroxysteroid dehydrogenase type 1 gene polymorphisms is associated with protective effect against insulin resistance.
22357964 Reduced intra-adipose glucocorticoid regeneration by 11beta-HSD1 is a novel mechanism that contributes to the metabolic efficacy of salicylates.
22310475 These data, which link an HSD11B1 genotype with both disease prevalence and its related phenotypes, strongly support a role for the rs3753519 polymorphism in the pathogenesis of pediatric-onset obesity.
22238371 genetic association studies in population of women in Alabama: Data suggest that genetic variations in HSD11B1 and CYP17A1 are not major risk factors for polycystic ovary syndrome; 8 SNP in HSD11B1 and 4 SNP in CYP17A1 were investigated.
22207732 Identify a positive cross-talk between PPARgamma and glucocorticoid receptor in human M2 macrophages via the induction of 11beta-HSD1 expression and activity.
22179810 GIP reduced expression and ex vivo activity of 11beta-hydroxysteroid dehydrogenase type 1 and adipose triglyceride lipase expression in subcutaneous fat biopsies.
22136330 11beta-HSD1 visceral adipose tissue expression is associated with the presence of non-alcoholic fatty liver disease.
22112815 11beta-HSD1 is implicated in human HPA axis regulation and susceptibility to depression.
21869537 Polymorphisms in the HSD11B1 gene may not be associated with type 2 diabetes and the metabolic syndrome.
21825133 demonstrated expression of mRNA for 11beta-HSD-1 and 11beta-HSD-2 and protein for 11beta-HSD-1 in rat and human pancreatic islets and insulinoma cells
21736538 Data suggest hepatic HSD11B1 activity is increased in postmenopausal women compared with premenopausal women. Investigation used oral cortisone acetate test to estimate hepatic HSD11B1 activity.
21704348 The overexpression of 11beta-hydroxysteroid dehydrogenase type 1 in visceral adipose tissue is associated with hyperinsulinemia in morbidly obese patients.
21695543 Elevated 11beta-HSD1 activity in clinically inactive inflammatory bowel disease implicates gastrointestinal glucocorticoid activation in the maintenance of disease remission.
21622477 In a population of Southern European Caucasian women with and without PCOS, alleles of HSD11B1 containing the two SNPs rs846910 A and rs12086634 T confer increased 11beta-HSD1 expression and activity, which associates with the metabolic syndrome.
21544007 Short-small-for-Gestational-Age condition is associated with enhanced glucocorticoid-stimulated 11beta-HSD-1 activity.
21453287 11beta-HSD1 is responsible for 7-oxolithocholic acid reduction in humans, providing a further link between hepatic glucocorticoid activation and bile acid metabolism
21402901 There were no significant associations between any HSD11B1 SNP and blood pressure or body mass index that could have confounded the association with LVM.
21362233 11beta-HSD2 is at least partly responsible for glucocorticoid resistance in Jurkat cells.
21325058 Simultaneous expression of mutant and WT 11beta-HSD1 in bacterial or mammalian cells, to simulate the heterozygous condition, indicated a marked suppressive effect of the mutants on both the yield and activity of 11beta-HSD1 dimers
21304964 11beta-HSD1 controls glucocorticoid-induced protein degradation in human and murine skeletal muscle via regulation of the E3 ubiquitin ligases Atrogin-1 and MuRF-1.
21267686 Low expression of 11beta-hydroxysteroid dehydrogenase type 1 is associated with breast cancer.
21266326 Whole-body 11beta-HSD1 activity is increased in obese men with type 2 diabetes, whereas liver 11beta-HSD1 activity is sustained, unlike in euglycemic obesity.
21249616 Insulin resistance observed in skeletal muscle of centrally obese subjects is not mediated by 11betaHSD1.
21215738 tissue- and differentiation state-specific promoter usage in expression of human HSD11B
21189603 Glucocorticoids induce the expression of 11beta-HSD1 in cultured chorionic trophoblasts.
21147223 Expression of 11beta-hydroxysteroid dehydrogenase type 1 in visceral and subcutaneous adipose tissues of patients with polycystic ovary syndrome is associated with adiposity
21111044 The 83,557insA variant of the gene coding 11beta-hydroxysteroid dehydrogenase type 1 enzyme associates with serum osteocalcin in patients with endogenous Cushing's syndrome.
20826586 Therapeutic weight loss in idiopathic intracranial hypertension is associated with a reduction in global 11beta-HSD1 activity.
20800085 Observational study of gene-disease association. (HuGE Navigator)
20739946 age- and site-associated increase in dermal 11beta-HSD1, and the ensuing increased local glucocorticoid activation, may contribute to the adverse changes in skin morphology and function associated with chronological aging and photoaging
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20514603 11beta-HSD-1 activity in subcutaneous adipose tissue was significantly increased in obese subjects with or without type 2 diabetes compared to lean subjects without diabetes.
20486282 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20100573 Recent progress on the biochemical characterization of 11beta-HSD1, with a focus on cofactor and substrate specificity and on possible alternative functions of this enzyme.
20045052 11beta-HSD1 acts at the interface of inflammation and obesity and represents an efficient integrator and effector of local inflammatory and metabolic state.
20041117 Postmenopausal normal weight women have increased 11betaHSD1 activity in adipose tissue and liver.
19934376 Compared with the common G allele, the A allele of rs13306421, a polymorphism located two nucleotides 5' to the translation initiation site, gave higher 11 beta-HSD1 expression and activity in vitro and was translated at higher levels.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19880789 Induction of 11beta-HSD1 activity and expression by inflammatory cytokines may enhance orbital adipocyte differentiation (adipogenesis) and limit proliferation in TAO. 11beta-HSD1 may also have a role in regulating the local orbital inflammatory response.
19876004 Observational study of gene-disease association. (HuGE Navigator)
19806478 IL-1beta induces the expression of 11beta-HSD1 mRNA in the fetal lung tissue through mechanisms that involve C/EBPbeta binding to the promoter.
19690925 11beta-HSD1 expression is higher in liver than in adipose tissue in obese patient., suggesting that this enzyme might have a pathogenic role in obesity and related metabolic disorders.
19675138 Selective 11beta-HSD1 inhibition decreases lipogenic and lipolytic gene expression that may represent an important mechanism underpinning their insulin-sensitizing action.
19651257 These results provide preliminary evidence supporting an association of HSD11B1 with osteoporosis in postmenopausal women.
19651257 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19571556 The variations in HSD11B1 were not associated with susceptibility to type 2 diabetes or metabolic phenotypes in Koreans. However, the common promoter variants of the gene might exert a polymorphic regulatory effect on HSD11B1 expression.
19567539 a relatively higher 11 beta-HSD1 activity in Omentum vs. sc adipose tissue is associated with preferential visceral fat accumulation and concomitant metabolic alterations.
19564704 TLR4 signaling and higher 11beta-HSD1 and GR levels in VAT may contribute predominantly to inflammatory factor production and subsequent metabolic sequelae in obese human.
19549748 Growth hormone did not regulate 11beta-HSD1 rapidly in vivo in humans.
19542242 A lower expression and activity of 11beta-HSD1 in the chorionic plate of the small for gestational age placentas.
19540999 Disease activity exerts a significant impact on 11beta-hydroxysteroid dehydrogenase activity in acromegalic patients.
19535162 No significan association betweeen metaboic syndrome X and single nucleotide polymorphisms in the 11beta-HSD1 gene in an urban Japanese cohort.
19535162 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429429 Data show that 18alpha-glycyrrhetinic acid selectively inhibits 11beta-hydroxysteroid dehydrogenase (HSD)1 but not 11beta-HSD2, while 18beta-GA preferentially inhibits 11beta-HSD2.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19282465 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19251840 These novel findings identify a Th2 cytokine-driven homeostatic feedback mechanism in airway smooth muscle that enhances its responsiveness to endogenous glucocorticoids by upregulating 11beta-HSD1 activity.
19235128 Identification of the 11 beta-hydroxysteroid dehydrogenase type 1 mRNA and protein in human mononuclear leukocytes.
19167490 Data suggest that production of 7beta- hydroxy-epiandrosterone through the 11beta-hydroxysteroid dehydrogenase type 1-mediated interconversion process could be important in controlling inflammation and related consequences.
19158196 Inhibition of 11betaHSD2 by cortisol may be a rational novel therapy for heavy menstrual bleeding.
19129713 Expression and activity of 11beta-hydroxysteroid dehydrogenase type 1 enzyme in subcutaneous and visceral adipose tissue of prepubertal children.
19121282 Using co-immunoprecipitation experiments with purified H6PDH and 11beta-HSD1, and with cell lysates expressing H6PDH and 11beta-HSD1, we observe direct physical interaction between the two enzymes.
19088256 Involvement of p38 MAPK in the TNF-alpha-mediated 11beta-HSD1 regulation; TNF-alpha stimulates enzyme activity in vivo.
19022912 upregulation of skeletal muscle 11betaHSD1 activity in response to a physiological stressor: abdominal surgery
19022342 The transcription levels of 11beta-HSD1 and 11beta-HSD2 in patients diagnosed with Crohn's disease or ulcerative colitis, was investigated.
19019335 Observational study of gene-disease association. (HuGE Navigator)
19010388 The impact of H6PDH on the modulation of 11beta-HSD1-dependent interconversion of cortisone and cortisol by inhibitors and alternative substrates, was investigated.
18963204 Data show that failure to down-regulate HSD11B1 activity in patients with type 2 diabetes may contribute to the pathogenesis of T2DM.
18837961 relationship between circulating 11beta-HSD1 mRNA levels & cardiovascular risk factors; results suggest decreased expression of 11beta-HSD1 with increased smoking, BMI & length of menopause; increased expression seen with increasing age & alcohol intake
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18778749 A NADPH/NADP(+) ratio of ten or higher was required for efficient microsomal 11beta-HSD1 reductase activity.
18769825 The CAI5 and CAI9 polymorphism correlated with changes in biochemical parameters in HPA and renin-angiotensin-aldosterone axis of obese essential hypertensives.
18769825 Observational study of gene-disease association. (HuGE Navigator)
18716005 Endogenous 11 beta-HSD1 and 11 beta-HSD2 play significant and distinct roles in modulating the effect of glucocorticoids on eNOS expression.
18665910 Hepatic 11beta-HSD1 and H6PDH are closely interlinked. 11beta-HSD1 gene expression does not seem to be involved in the pathogenesis of fatty liver or nonalcoholic steatohepatitis.
18633104 Increased adipose 11beta-HSD1 expression in women may contribute to glucose intolerance.
18611262 SNPs in HSD11B1 and IRS2 mark regions of the genome that may harbor risk alleles for breast cancer
18611262 Observational study of gene-disease association. (HuGE Navigator)
18592327 11beta-Hydroxysteroid dehydrogenase type 1 (11beta-HSD1) enzyme catalyzes interconversion of inactive cortisone to active cortisol.
18573267 Variable expression of HSD11B1 in vascular endothelial cells is reported.
18434359 The increase in 11beta-HSD1 mRNA expression and activity is essential for the induction of human adipogenesis.
18388900 Type 1 HSD (HSD1) mRNA and reductase activity were mainly expressed within adipocytes and tightly correlated with adipocyte size.
18379559 no direct effect of estrogen on adipose 11beta-HSD1 was found in liposuctioned adiose tissue
18313835 Data suggest that humoral factors related to metabolic syndrome synergistically enhance hepatic expression of 11beta-hydroxysteroid dehydrogenase type 1 and cause Cushing state in the liver by increasing the intracellular glucocorticoid level.
18261751 Data show that normal human kidney contains active 11beta-HSD1 and 11beta-HSD2, and that 11beta-HSD1 co-localizes with COX-2 in proximal tubule cells.
18031327 These results indicate significant induction of HSD11B1 gene expression and activity in patients with alcoholic liver disease during short- and long-term abstinence from alcohol.
17922306 data suggest a cell-type specific regulation of the 11beta-HSD1 promoter, which is in agreement with existing expression data from animal and human studies
17912154 In obesity, 11beta-HSD1 is decreased in the liver and increased in adipose tissue. Polymorphisms in the 11beta-HSD1 gene are also associated with components of the metabolic syndrome. Review.
17825335 These findings support the hypothesis that the oxido-reductase and epimerase activities of 11beta-HSD1 depend on the positioning of the steroid substrates within the active site and may provide insight into its fine structure and mechanism of action.
17766714 11beta-HSD1 activity increases with age, and is reduced in obese boys
17588937 cellular trafficking of G6P directly regulates 11beta-HSD1 reductase activity and provides a novel link between glucose metabolism and function of the hypothalamo-pituitary-adrenal axis.
17519316 skeletal muscle 11beta-HSD1 and 11beta-HSD2 are altered in diabetes, which together may reduce intracellular cortisol generation, potentially conferring metabolic protection
17495191 GRalpha mRNA is reduced in the omental depot with obesity. The novel correlation of 11betaHSD1 with omental fat cell size is independent of obesity.
17467270 Presence of both CYP7B1 and 11beta-HSD1 in human skin.
17306259 Y280 is not involved in substrate binding but rather plays a selective role in inhibitor binding. The involvement of Y280 in inhibitor binding depends on the inhibitor chemical structure.
17062770 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17032748 HSD11B1's expression pattern in subcutaneous and omental adipose tissues.
16996097 Results suggest that gene expression modulation by glucocorticoids is under a decisive influence of target cell 11beta-hydroxysteroid dehydrogenase-1 that modulates the intracellular concentration of active glucocorticoids.
16914598 the lack of increase of 11beta-HSD1 expression in Cushing's syndrome could suggest downregulation of the enzyme as a result of long-term overstimulatio
16855188 Results strengthen the importance of 11beta-HSD-1 in obesity and its associated complications and suggest the need of clinical studies with specific 11beta-HSD-1 inhibitors.
16622297 11HSD1 is altered in a tissue-specific manner with reduced levels in liver but elevated levels in adipose tissue. Some polymorphisms have been demonstrated in intronic and upstream regions of the HSD11B1 gene.
16603347 is a steroid oxidoreductase able to use and produce 7alpha- and 7beta-hydroxy-DHEA through an oxidoreduction process generating the 7-oxo-DHEA intermediate
16580270 The hydroxyl side chain of Y177 is likely involved with hyrogen bonding with the 3-hydroxy group of A ring of glycyrrhetinic acid.
16551740 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16469798 cortisol up-regulates 11beta-HSD1 expression through induction of promoter activity, and the effect is enhanced by IL-1beta
16412558 ER-lumenal orientation of 11beta-HSD1 is essential for the metabolism of the alternative substrate 7-ketocholesterol (7KC), a major cholesterol oxidation product found in atherosclerotic plaques and taken up from processed cholesterol-rich food.
16406280 There was up-regulated expression of 11betaHSD-1 at menstruation and in first trimester decidua.
16368752 Somatotropin treatment is able to decrease 11beta-HSD1 mRNA and increase 11beta-HSD2 and accordingly may be able to reduce the amount of locally produced cortisol in adipose tissue.
16343739 11beta-HSD1 has a role in the metabolism of xenobiotic carbonyl compounds.
16236446 Observational study of gene-disease association. (HuGE Navigator)
16091483 Observational study of gene-disease association. (HuGE Navigator)
15941907 monocyte-derived DCs are able to generate cortisol as a consequence of up-regulated 11beta-HSD1 expression. Immature DCs demonstrate selective enhancement of 11beta-HSD1 activity, leading to increased conversion of inactive cortisone to active cortisol.
15855321 The portal vein delivers cortisol to the liver, and inhibition of 11HSD1 in visceral adipose tissue may be valuable in ameliorating insulin resistance in obesity.
15827106 Observational study of gene-disease association. (HuGE Navigator)
15591536 a molecular switch during osteoblast differentiation controls 11beta-Hydroxysteroid dehydrogenase expression and glucocorticoid synthesis
15536220 Observational study of gene-disease association. (HuGE Navigator)
15513927 crystal structure of human 11beta-hydroxysteroid dehydrogenase type I
15455200 HIV patients treated with HAART showewd an increase in mRNA of this enzyme in adipose tissue, correlated with insulin resistance.
15452033 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15452033 The current study provides additional evidence that variability at the 11[beta]HSD1 gene begets the development of hypertension and that over the years changes in the environment have modified the effect of 11[beta]HSD1 on blood pressure in Pima Indians.
15280030 Hexose-6-phosphate dehydrogenase directly determines the reaction direction of 11beta-Hydroxysteroid dehydrogenase1 in intact cells as an oxoreductase.
15181046 Decreased 11betaHSD1 activity and expression in obesity may act as a compensatory mechanism to enhance insulin sensitivity through a reduction in tissue-specific cortisol concentrations.
15172126 Decrease of 11betaHSD1 mRNA abundance and enzyme activity is associated with colorectal cancer
15167446 Observational study of gene-disease association. (HuGE Navigator)
15156315 Observational study of gene-disease association. (HuGE Navigator)
15156315 P.1088: "...genetic variations in the HSD11B1 gene were associated with Type 2 diabetes mellitus, plasma insulin concentrations and insulin action, independent of obesity."
15152005 role of the N-terminal region on enzymatic activity and the relevance of 11beta-HSD1 orientation into the endoplasmic reticulum lumen
15095019 Data report on the in vitro oxysterol-metabolizing properties of human and rodent 11beta-hydroxysteroid dehydrogenase.
14742837 data suggest increased expression of the 11beta-HSD1 gene is associated with metabolic abnormalities in obese women and that increased expression may contribute to increased local conversion of cortisone to cortisol in adipose tissue of obese individuals
14682470 REVIEW: role in cortisol metabolism and visceral obesity
14583441 Observational study of gene-disease association. (HuGE Navigator)
14557491 increases in 11beta-HSD 1 expression/activity by intrauterine membranes during late gestation may result in increased potential for a local increase in fetal membranes should be considered as an extraadrenal source of cortisol during late gestation.
12960005 glucocorticoids can positively induce 11beta-HSD1 expression in amnion fibroblasts, an effect further strengthened by proinflammatory cytokines.
12915696 idiopathic obesity is associated with transcriptional up-regulation of 11HSD1 in adipose tissue
12915682 11beta-HSD1 activity may predict individual susceptibility to glucocorticoid-induced osteoporosis
12861241 Observational study of gene-disease association. (HuGE Navigator)
12858176 Mutations in the genes encoding 11beta-hydroxysteroid dehydrogenase type 1 and hexose-6-phosphate dehydrogenase interact to cause cortisone reductase deficiency.
12788882 Higher adipose 11-HSD1 activity is associated with features of metabolic syndrome.
12530692 May regulate levels of glucocorticoids. Plasma cortisol levels could be predicted by a model incorporating adrenal HSD11B2 and tumor size.
12530648 Acts as dehydrogenase inactivating cortisol to cortisone. 11beta-HSD1 dehydrogenase activity in "uncommitted" omental preadipocytes may provide autocrine mechanism to protect preadipocytes from differentiation, facilitating proliferation.
12414862 Observational study of gene-disease association. (HuGE Navigator)
12390875 There is colocalization of 11beta-HSD1 and GR in the chorionic trophoblast. By binding to GR, glucocorticoids induce the expression of 11beta-HSD1 by a possible intracrine mechanism.
12202416 cultured human ovarian surface epithelium (HOSE) cells express IL-1-responsive 11betaHSD1 mRNA
12109593 11beta-Hydroxysteroid dehydrogenase types 1 and 2 are up- and downregulated in cortisol-secreting adrenal adenomas.
11956655 Human adrenal cortex and aldosterone secreting adenomas express both 11beta-hydroxysteroid dehydrogenase type 1 and type 2 genes.
11755176 Effect of cellular differentiation on 11beta-hydroxysteroid dehydrogenase activity in the intestine
11114699 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET      1 - 70
LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM     71 - 140
EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI    141 - 210
TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY    211 - 280
STSYNMDRFINK                                                              281 - 292
//

Text Mined References (220)

PMID Year Title
26671915 2015 Association between ins4436A in 11?-hydroxysteroid dehydrogenase type 1 gene and essential hypertension in Polish population.
26528718 2015 Metabolic Coupling Determines the Activity: Comparison of 11?-Hydroxysteroid Dehydrogenase 1 and Its Coupling between Liver Parenchymal Cells and Testicular Leydig Cells.
26452272 2015 Association Analysis between the Polymorphisms of HSD11B1 and H6PD and Risk of Polycystic Ovary Syndrome in Chinese Population.
26163245 The expression of 11?-hydroxysteroid dehydrogenase type 1 and 2 in nasal polyp-derived epithelial cells and its possible contribution to glucocorticoid activation in nasal polyp.
25989394 2015 Gender-Specific Differences in Skeletal Muscle 11?-HSD1 Expression Across Healthy Aging.
25788665 2015 The Role of Placental 11-Beta Hydroxysteroid Dehydrogenase Type 1 and Type 2 Methylation on Gene Expression and Infant Birth Weight.
25751397 2015 Impact of HSD11B1 polymorphisms on BMI and components of the metabolic syndrome in patients receiving psychotropic treatments.
25666420 2015 Glucocorticoids and 11?-hydroxysteroid dehydrogenases: mechanisms for hypertension.
25659145 2015 UFSRAT: Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11?HSD1.
25436731 2013 The role and regulation of 11?-hydroxysteroid dehydrogenase type 1 in obesity and the metabolic syndrome.
25393644 2015 11?-Hydroxysteroid dehydrogenase activity in the brain does not contribute to systemic interconversion of cortisol and cortisone in healthy men.
24969481 2014 Genetic variants of the HSD11B1 gene promoter may be protective against polycystic ovary syndrome.
24915124 2014 Common genetic variants in the glucocorticoid receptor and the 11?-hydroxysteroid dehydrogenase type 1 genes influence long-term cognitive impairments in patients with Cushing's syndrome in remission.
24810847 2014 Expression of 11?-hydroxysteroid dehydrogenase 1 and 2 in patients with chronic rhinosinusitis and their possible contribution to local glucocorticoid activation in sinus mucosa.
24729284 2014 Variants of 11?-hydroxysteroid dehydrogenase (HSD11B) gene type 1 and 2 in Chinese obese adolescents.
24447082 2014 Differential expression of 11?-hydroxysteroid dehydrogenase type 1 and 2 in mild and moderate/severe persistent allergic nasal mucosa and regulation of their expression by Th2 cytokines: asthma and rhinitis.
24391882 2013 Increased skeletal muscle 11?HSD1 mRNA is associated with lower muscle strength in ageing.
24285685 2014 Genetic polymorphisms in 11?-hydroxysteroid dehydrogenase type 1 correlate with the postdexamethasone cortisol levels and bone mineral density in patients evaluated for osteoporosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24243637 2014 Proinflammatory cytokine induction of 11?-hydroxysteroid dehydrogenase type 1 (11?-HSD1) in human adipocytes is mediated by MEK, C/EBP?, and NF-?B/RelA.
24149070 2013 Switch of glycolysis to gluconeogenesis by dexamethasone for treatment of hepatocarcinoma.
24147632 2014 Comparison between placental gene expression of 11?-hydroxysteroid dehydrogenases and infantile growth at 10 months of age.
24122936 2014 Cortisone induces insulin resistance in C2C12 myotubes through activation of 11beta-hydroxysteroid dehydrogenase 1 and autocrinal regulation.
24086653 2013 Pro-inflammatory cytokine induction of 11?-hydroxysteroid dehydrogenase type 1 in A549 cells requires phosphorylation of C/EBP? at Thr235.
24061267 2013 A variant (rs932335) in the HSD11B1 gene is associated with colorectal cancer in a Chinese population.
24055708 2013 11?-Hydroxysteroid dehydrogenase 1 contributes to the pro-inflammatory response of keratinocytes.
24054540 2013 Postdate pregnancy: changes of placental/membranes 11?-hydroxysteroid dehydrogenase mRNA and activity.
23979790 2013 The expression of 11?-HSDs, GR, and H6PDH in subcutaneous adipose tissue from polycystic ovary syndrome subjects.
23874920 2013 A pharmacological screening approach for discovery of neuroprotective compounds in ischemic stroke.
23869418 2013 Association between a 11?-hydroxysteroid dehydrogenase type 1 gene polymorphism and metabolic syndrome in a South Indian population.
23836520 2014 Adipose tissue 11?HSD1 gene expression, ?cell function and ectopic fat in obese African Americans versus Hispanics.
23778418 2013 Modulatory effect of BclI GR gene polymorphisms on the obesity phenotype in Brazilian patients with Cushing's disease.
23722901 2013 11?-Hydroxysteroid dehydrogenase blockade prevents age-induced skin structure and function defects.
23701286 2013 Differences between men and women in the regulation of adipose 11?-HSD1 and in its association with adiposity and insulin resistance.
23678035 2013 Ovarian 11?-hydroxysteroid dehydrogenase (11?HSD) activity is suppressed in women with anovulatory polycystic ovary syndrome (PCOS): apparent role for ovarian androgens.
23659736 2013 Glucocorticoid synthesis-related genes: HSD11B1 and HSD11B2 in hypertensive disorders in pregnancy.
23612224 2013 11?-Hydroxysteroid dehydrogenase 1: translational and therapeutic aspects.
23375992 2013 Association of 11?-hydroxysteroid dehydrogenase type 1 gene polymorphisms with serum alanine aminotransferase activity.
23362866 2013 Expression profiles of cortisol-inactivating enzyme, 11?-hydroxysteroid dehydrogenase-2, in human epidermal tumors and its role in keratinocyte proliferation.
23190557 2012 Association of 11?-hydroxysteroid dehydrogenase type I expression and activity with estrogen receptor ? in adipose tissue from postmenopausal women.
23090578 2013 The environmental obesogen bisphenol A promotes adipogenesis by increasing the amount of 11?-hydroxysteroid dehydrogenase type 1 in the adipose tissue of children.
23017470 2013 Identification of microRNAs as a potential novel regulatory mechanism in HSD11B1 expression.
23009206 2012 The role of mediastinal adipose tissue 11?-hydroxysteroid d ehydrogenase type 1 and glucocorticoid expression in the development of coronary atherosclerosis in obese patients with ischemic heart disease.
23007990 2012 11?-hydroxysteroid dehydrogenase type 1 gene expression is increased in ascending aorta tissue of metabolic syndrome patients with coronary artery disease.
22986073 2012 The rs4844880 polymorphism in the promoter region of the HSD11B1 gene associates with bone mineral density in healthy and postmenopausal osteoporotic women.
22719058 2012 Expression of 11?-hydroxysteroid dehydrogenase enzymes in human osteosarcoma: potential role in pathogenesis and as targets for treatments.
22445027 2012 Polymorphisms of POR, SULT2A1 and HSD11B1 in children with premature adrenarche.
22384521 2012 Association between 11beta-hydroxysteroid dehydrogenase type 1 gene polymorphisms and metabolic syndrome in Bosnian population.
22357964 2012 Salicylate downregulates 11?-HSD1 expression in adipose tissue in obese mice and in humans, mediating insulin sensitization.
22310475 2012 A gene variant of 11?-hydroxysteroid dehydrogenase type 1 is associated with obesity in children.
22238371 2012 Association study of CYP17 and HSD11B1 in polycystic ovary syndrome utilizing comprehensive gene coverage.
22207732 2012 Peroxisome proliferator-activated receptor-? activation induces 11?-hydroxysteroid dehydrogenase type 1 activity in human alternative macrophages.
22179810 2012 Glucose-dependent insulinotropic polypeptide reduces fat-specific expression and activity of 11?-hydroxysteroid dehydrogenase type 1 and inhibits release of free fatty acids.
22136330 2012 Overexpression of 11?-hydroxysteroid dehydrogenase type 1 in visceral adipose tissue and portal hypercortisolism in non-alcoholic fatty liver disease.
22112815 2012 The effect of common genetic variation in 11?-hydroxysteroid dehydrogenase type 1 on hypothalamic-pituitary-adrenal axis activity and incident depression.
21869537 2011 Relationship of 11?-hydroxysteroid dehydrogenase type 1 and hexose-6-phosphate dehydrogenase gene polymorphisms with metabolic syndrome and type 2 diabetes.
21825133 2011 Modulation of pancreatic islets-stress axis by hypothalamic releasing hormones and 11beta-hydroxysteroid dehydrogenase.
21736538 2011 Effects of menopause on hepatic 11?-hydroxysteroid dehydrogenase type 1 activity and adrenal sensitivity to adrenocorticotropin in healthy non-obese women.
21704348 2011 Overexpression of hepatic 5?-reductase and 11?-hydroxysteroid dehydrogenase type 1 in visceral adipose tissue is associated with hyperinsulinemia in morbidly obese patients.
21695543 2011 Can 11?-hydroxysteroid dehydrogenase activity predict the sensitivity of bone to therapeutic glucocorticoids in inflammatory bowel disease?
21622477 2011 A combination of polymorphisms in HSD11B1 associates with in vivo 11{beta}-HSD1 activity and metabolic syndrome in women with and without polycystic ovary syndrome.
21544007 2011 11?-Hydroxysteroid dehydrogenase type 1 activity in short small-for-GA children and in response to GH therapy.
21453287 2011 Hepatic reduction of the secondary bile acid 7-oxolithocholic acid is mediated by 11?-hydroxysteroid dehydrogenase 1.
21402901 2011 Common variation at the 11-? hydroxysteroid dehydrogenase type 1 gene is associated with left ventricular mass.
21362233 2011 [Expression of 11?-hydroxysteroid dehydrogenase type 2 in lymphoblastic cells and its relationship with glucocorticoid sensitivity].
21325058 2011 Cortisone-reductase deficiency associated with heterozygous mutations in 11beta-hydroxysteroid dehydrogenase type 1.
21304964 2011 Skeletal muscle 11beta-HSD1 controls glucocorticoid-induced proteolysis and expression of E3 ubiquitin ligases atrogin-1 and MuRF-1.
21267686 2011 Expression of 11?-hydroxysteroid dehydrogenase type 1 in breast cancer and adjacent non-malignant tissue. An immunocytochemical study.
21266326 2011 Increased whole-body and sustained liver cortisol regeneration by 11beta-hydroxysteroid dehydrogenase type 1 in obese men with type 2 diabetes provides a target for enzyme inhibition.
21249616 2011 Skeletal muscle 11?HSD1 activity of nondiabetic subjects is unaltered in central obesity-associated insulin resistance.
21215738 2011 Analysis of alternative promoter usage in expression of HSD11B1 including the development of a transcript-specific quantitative real-time PCR method.
21189603 2003 [Glucocorticoids up-regulate human chorion 11beta-hydroxysteroid dehydrogenase type 1].
21147223 2011 Expression of 11?-hydroxysteroid dehydrogenase type 1 in visceral and subcutaneous adipose tissues of patients with polycystic ovary syndrome is associated with adiposity.
21111044 2011 The 83,557insA variant of the gene coding 11?-hydroxysteroid dehydrogenase type 1 enzyme associates with serum osteocalcin in patients with endogenous Cushing's syndrome.
20826586 2010 Cerebrospinal fluid corticosteroid levels and cortisol metabolism in patients with idiopathic intracranial hypertension: a link between 11beta-HSD1 and intracranial pressure regulation?
20800085 2010 SRD5A2 is associated with increased cortisol metabolism in schizophrenia spectrum disorders.
20739946 2011 Localization, age- and site-dependent expression, and regulation of 11?-hydroxysteroid dehydrogenase type 1 in skin.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20514603 2010 Repeated measurements of 11?-HSD-1 activity in subcutaneous adipose tissue from lean, abdominally obese, and type 2 diabetes subjects--no change following a mixed meal.
20486282 2010 Genetic variants in the renin-angiotensin-aldosterone system and salt sensitivity of blood pressure.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20100573 2010 The glucocorticoid-activating enzyme 11beta-hydroxysteroid dehydrogenase type 1 has broad substrate specificity: Physiological and toxicological considerations.
20045052 2010 11beta-Hydroxysteroid dehydrogenase type 1 is an important regulator at the interface of obesity and inflammation.
20041117 2009 Tissue-specific increases in 11beta-hydroxysteroid dehydrogenase type 1 in normal weight postmenopausal women.
19946888 2010 Defining the membrane proteome of NK cells.
19934376 2010 Functional effects of polymorphisms in the human gene encoding 11 beta-hydroxysteroid dehydrogenase type 1 (11 beta-HSD1): a sequence variant at the translation start of 11 beta-HSD1 alters enzyme levels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19880789 2010 The role of 11beta-hydroxysteroid dehydrogenase 1 in adipogenesis in thyroid-associated ophthalmopathy.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19806478 2009 Stimulation of 11?-HSD1 expression by IL-1? via a C/EBP binding site in human fetal lung fibroblasts.
19690925 2010 Overexpression of 11beta-hydroxysteroid dehydrogenase type 1 in hepatic and visceral adipose tissue is associated with metabolic disorders in morbidly obese patients.
19675138 2009 11beta-hydroxysteroid dehydrogenase type 1 regulates glucocorticoid-induced insulin resistance in skeletal muscle.
19651257 2009 HSD11B1 polymorphisms predicted bone mineral density and fracture risk in postmenopausal women without a clinically apparent hypercortisolemia.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19571556 2009 Regulatory effect of common promoter polymorphisms on the expression of the 11beta-hydroxysteroid dehydrogenase type 1 gene.
19567539 2009 Omental adipose tissue type 1 11 beta-hydroxysteroid dehydrogenase oxoreductase activity, body fat distribution, and metabolic alterations in women.
19564704 2009 Comparison of gene transcription between subcutaneous and visceral adipose tissue in Chinese adults.
19549748 2009 Lack of regulation of 11beta-hydroxysteroid dehydrogenase type 1 during short-term manipulation of GH in patients with hypopituitarism.
19542242 2009 Differences in expression and activity of 11beta-hydroxysteroid dehydrogenase type 1 and 2 in human placentas of term pregnancies according to birth weight and gender.
19540999 2009 11beta-hydroxysteroid dehydrogenase activity in acromegalic patients with normal or impaired carbohydrate metabolism.
19535162 2009 Association study of 11beta-hydroxysteroid dehydrogenase type 1 gene polymorphisms and metabolic syndrome in urban Japanese cohort.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19429429 2009 Selective inhibition of 11beta-hydroxysteroid dehydrogenase 1 by 18alpha-glycyrrhetinic acid but not 18beta-glycyrrhetinic acid.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19282465 2009 Glucocorticoid replacement therapy and pharmacogenetics in Addison's disease: effects on bone.
19251840 2009 Th2 cytokine-induced upregulation of 11beta-hydroxysteroid dehydrogenase-1 facilitates glucocorticoid suppression of proasthmatic airway smooth muscle function.
19235128 2009 Identification of the 11 beta-hydroxysteroid dehydrogenase type 1 mRNA and protein in human mononuclear leukocytes.
19217779 2009 Discovery and optimization of piperidyl benzamide derivatives as a novel class of 11beta-HSD1 inhibitors.
19167490 2009 Epimerase activity of the human 11beta-hydroxysteroid dehydrogenase type 1 on 7-hydroxylated C19-steroids.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19158196 2009 Cortisol inactivation by 11beta-hydroxysteroid dehydrogenase-2 may enhance endometrial angiogenesis via reduced thrombospondin-1 in heavy menstruation.
19129713 2009 Expression and activity of 11beta-hydroxysteroid dehydrogenase type 1 enzyme in subcutaneous and visceral adipose tissue of prepubertal children.
19121282 2009 H6PDH interacts directly with 11beta-HSD1: implications for determining the directionality of glucocorticoid catalysis.
19088256 2009 Tumor necrosis factor-alpha upregulates 11beta-hydroxysteroid dehydrogenase type 1 expression by CCAAT/enhancer binding protein-beta in HepG2 cells.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19022912 2009 Skeletal muscle 11beta hydroxysteroid dehydrogenase type 1 activity is upregulated following elective abdominal surgery.
19022342 2009 Expression profiles of human 11beta-hydroxysteroid dehydrogenases type 1 and type 2 in inflammatory bowel diseases.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19010388 2009 Hexose-6-phosphate dehydrogenase modulates the effect of inhibitors and alternative substrates of 11beta-hydroxysteroid dehydrogenase 1.
18963204 2008 Adipose tissue 11-beta-Hydroxysteroid Dehydrogenase Type 1 and Hexose-6-Phosphate Dehydrogenase gene expressions are increased in patients with type 2 diabetes mellitus.
18837961 2008 Circulating 11beta-hydroxysteroid dehydrogenase type 1 mRNA and cardiovascular risk factors.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18778749 2009 11beta-Hydroxysteroid dehydrogenase 1 reductase activity is dependent on a high ratio of NADPH/NADP(+) and is stimulated by extracellular glucose.
18769825 2008 [Possible pathogenetic role of 11 beta-hydroxysteroid dehydrogenase type 1 (11betaHSD1) gene polymorphisms in arterial hypertension].
18716005 2009 Glucocorticoid response elements and 11 beta-hydroxysteroid dehydrogenases in the regulation of endothelial nitric oxide synthase expression.
18665910 2009 Hepatic 11beta-HSD1 mRNA expression in fatty liver and nonalcoholic steatohepatitis.
18633104 2008 Impaired glucose tolerance and insulin resistance are associated with increased adipose 11beta-hydroxysteroid dehydrogenase type 1 expression and elevated hepatic 5alpha-reductase activity.
18611262 2008 Genetic variation in candidate obesity genes ADRB2, ADRB3, GHRL, HSD11B1, IRS1, IRS2, and SHC1 and risk for breast cancer in the Cancer Prevention Study II.
18592327 2009 11beta-hydroxysteroid dehydrogenase type 1 is overexpressed in subcutaneous adipose tissue of morbidly obese patients.
18573267 2008 Variable expression of 11beta Hydroxysteroid dehydrogenase (11beta-HSD) isoforms in vascular endothelial cells.
18553955 2008 Discovery of novel, potent benzamide inhibitors of 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1) exhibiting oral activity in an enzyme inhibition ex vivo model.
18485702 2008 Pyridine amides as potent and selective inhibitors of 11beta-hydroxysteroid dehydrogenase type 1.
18434359 2008 A novel selective 11beta-hydroxysteroid dehydrogenase type 1 inhibitor prevents human adipogenesis.
18388900 2008 Depot-specific regulation of the conversion of cortisone to cortisol in human adipose tissue.
18379559 2008 Upregulation of adipose 11-beta-hydroxysteroid dehydrogenase type 1 expression in ovariectomized rats is due to obesity rather than lack of estrogen.
18313835 2008 Is the metabolic syndrome an intracellular Cushing state? Effects of multiple humoral factors on the transcriptional activity of the hepatic glucocorticoid-activating enzyme (11beta-hydroxysteroid dehydrogenase type 1) gene.
18261751 2008 Human renal 11beta-hydroxysteroid dehydrogenase 1 functions and co-localizes with COX-2.
18069989 2008 Structural characterization and pharmacodynamic effects of an orally active 11beta-hydroxysteroid dehydrogenase type 1 inhibitor.
18031327 2008 Induction of hepatic 11beta-hydroxysteroid dehydrogenase type 1 in patients with alcoholic liver disease.
17922306 2007 Cell-type specific regulation of the human 11beta-hydroxysteroid dehydrogenase type 1 promoter.
17919905 2007 The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors.
17912154 2007 Glucocorticoids and 11beta-hydroxysteroid dehydrogenase type 1 in obesity and the metabolic syndrome.
17825335 2007 5Alpha-androstane-3beta,7alpha,17beta-triol and 5alpha-androstane-3beta,7beta,17beta-triol as substrates for the human 11beta-hydroxysteroid dehydrogenase type 1.
17766714 2007 Reduced 11beta-hydroxysteroid dehydrogenase type 1 activity in obese boys.
17588937 2007 11beta-Hydroxysteroid Dehydrogenase Type 1 Regulation by Intracellular Glucose 6-Phosphate Provides Evidence for a Novel Link between Glucose Metabolism and Hypothalamo-Pituitary-Adrenal Axis Function.
17519316 2007 Altered activity of 11beta-hydroxysteroid dehydrogenase types 1 and 2 in skeletal muscle confers metabolic protection in subjects with type 2 diabetes.
17495191 2007 Omental 11beta-hydroxysteroid dehydrogenase 1 correlates with fat cell size independently of obesity.
17467270 2007 Dehydroepiandrosterone 7alpha-hydroxylation in human tissues: possible interference with type 1 11beta-hydroxysteroid dehydrogenase-mediated processes.
17306259 2007 The selectivity of tyrosine 280 of human 11beta-hydroxysteroid dehydrogenase type 1 in inhibitor binding.
17070044 2007 Adamantane sulfone and sulfonamide 11-beta-HSD1 Inhibitors.
17062770 2007 Lack of Association of the 11beta-hydroxysteroid dehydrogenase type 1 gene 83,557insA and hexose-6-phosphate dehydrogenase gene R453Q polymorphisms with body composition, adrenal androgen production, blood pressure, glucose metabolism, and dementia.
17032748 2006 Expression profiling of 11beta-hydroxysteroid dehydrogenase type-1 and glucocorticoid-target genes in subcutaneous and omental human preadipocytes.
16996097 2006 Intracrine modulation of gene expression by intracellular generation of active glucocorticoids.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16914598 2006 Adipose tissue 11beta-hydroxysteroid dehydrogenase type 1 expression in obesity and Cushing's syndrome.
16855188 2006 11beta-hydroxysteroid dehydrogenase type 1 mRNA is increased in both visceral and subcutaneous adipose tissue of obese patients.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16622297 2006 Inhibition of 11beta-hydroxysteroid dehydrogenase type 1 in obesity.
16603347 2006 Inter-conversion of 7alpha- and 7beta-hydroxy-dehydroepiandrosterone by the human 11beta-hydroxysteroid dehydrogenase type 1.
16580270 2006 The role of tyrosine 177 in human 11beta-hydroxysteroid dehydrogenase type 1 in substrate and inhibitor binding: an unlikely hydrogen bond donor for the substrate.
16551740 2006 Genetic variation in 11beta-hydroxysteroid dehydrogenase type 1 predicts adrenal hyperandrogenism among lean women with polycystic ovary syndrome.
16469798 2006 Enhancement of cortisol-induced 11beta-hydroxysteroid dehydrogenase type 1 expression by interleukin 1beta in cultured human chorionic trophoblast cells.
16412558 2006 Why is 11beta-hydroxysteroid dehydrogenase type 1 facing the endoplasmic reticulum lumen? Physiological relevance of the membrane topology of 11beta-HSD1.
16406280 2006 11Beta-hydroxysteroid dehydrogenases in human endometrium.
16368752 2006 Growth hormone (GH) substitution in GH-deficient patients inhibits 11beta-hydroxysteroid dehydrogenase type 1 messenger ribonucleic acid expression in adipose tissue.
16343739 2006 11Beta-hydroxysteroid dehydrogenase type 1: purification from human liver and characterization as carbonyl reductase of xenobiotics.
16236446 2006 Polymorphisms in the gene encoding 11B-hydroxysteroid dehydrogenase type 1 (HSD11B1) and lifetime cognitive change.
16091483 2005 Genotypes at 11beta-hydroxysteroid dehydrogenase type 11B1 and hexose-6-phosphate dehydrogenase loci are not risk factors for apparent cortisone reductase deficiency in a large population-based sample.
15941907 2005 Expression of 11beta-hydroxysteroid dehydrogenase type 1 permits regulation of glucocorticoid bioavailability by human dendritic cells.
15855321 2005 The contribution of visceral adipose tissue to splanchnic cortisol production in healthy humans.
15827106 2005 A study of the hexose-6-phosphate dehydrogenase gene R453Q and 11beta-hydroxysteroid dehydrogenase type 1 gene 83557insA polymorphisms in the polycystic ovary syndrome.
15591536 2005 11beta-Hydroxysteroid dehydrogenase expression and glucocorticoid synthesis are directed by a molecular switch during osteoblast differentiation.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15536220 2004 Molecular screening of the 11beta-HSD1 gene in men characterized by the metabolic syndrome.
15513927 2005 Conformational flexibility in crystal structures of human 11beta-hydroxysteroid dehydrogenase type I provide insights into glucocorticoid interconversion and enzyme regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466942 2004 11beta-hydroxysteroid dehydrogenase type 1: a tissue-specific regulator of glucocorticoid response.
15455200 2004 In the lipodystrophy associated with highly active antiretroviral therapy, pseudo-Cushing's syndrome is associated with increased regeneration of cortisol by 11beta-hydroxysteroid dehydrogenase type 1 in adipose tissue.
15452033 2004 Interaction between an 11betaHSD1 gene variant and birth era modifies the risk of hypertension in Pima Indians.
15280030 2004 Hexose-6-phosphate dehydrogenase determines the reaction direction of 11beta-hydroxysteroid dehydrogenase type 1 as an oxoreductase.
15181046 2004 Weight loss increases 11beta-hydroxysteroid dehydrogenase type 1 expression in human adipose tissue.
15172126 2004 Expression of 11beta-hydroxysteroid dehydrogenase types 1 and 2 in colorectal cancer.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
15156315 2004 11beta-Hydroxysteroid dehydrogenase Type 1: genetic polymorphisms are associated with Type 2 diabetes in Pima Indians independently of obesity and expression in adipocyte and muscle.
15152005 2004 Appropriate function of 11beta-hydroxysteroid dehydrogenase type 1 in the endoplasmic reticulum lumen is dependent on its N-terminal region sharing similar topological determinants with 50-kDa esterase.
15095019 2004 Human and rodent type 1 11beta-hydroxysteroid dehydrogenases are 7beta-hydroxycholesterol dehydrogenases involved in oxysterol metabolism.
14742837 2004 Regulation of 11beta-HSD genes in human adipose tissue: influence of central obesity and weight loss.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14682470 2003 Cortisol metabolism and visceral obesity: role of 11beta-hydroxysteroid dehydrogenase type I enzyme and reduced co-factor NADPH.
14583441 2004 Glucocorticoid-related genetic susceptibility for Alzheimer's disease.
14557491 2003 Late gestation increase in 11beta-hydroxysteroid dehydrogenase 1 expression in human fetal membranes: a novel intrauterine source of cortisol.
12960005 2003 Enhancement of glucocorticoid-induced 11beta-hydroxysteroid dehydrogenase type 1 expression by proinflammatory cytokines in cultured human amnion fibroblasts.
12915696 2003 Local and systemic impact of transcriptional up-regulation of 11beta-hydroxysteroid dehydrogenase type 1 in adipose tissue in human obesity.
12915682 2003 11beta-hydroxysteroid dehydrogenase type 1 activity predicts the effects of glucocorticoids on bone.
12861241 2003 Associations between a polymorphism in the 11 beta hydroxysteroid dehydrogenase type I gene and body composition.
12858176 2003 Mutations in the genes encoding 11beta-hydroxysteroid dehydrogenase type 1 and hexose-6-phosphate dehydrogenase interact to cause cortisone reductase deficiency.
12788882 2003 Subcutaneous adipose 11 beta-hydroxysteroid dehydrogenase type 1 activity and messenger ribonucleic acid levels are associated with adiposity and insulinemia in Pima Indians and Caucasians.
12530692 2002 Role of local 11beta-hydroxysteroid dehydrogenase type 2 (HSD11B2) expression in determining the phenotype of adrenal adenomas.
12530648 2002 11Beta-hydroxysteroid dehydrogenase type 1 in differentiating omental human preadipocytes: from de-activation to generation of cortisol.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414862 2002 Association studies between microsatellite markers within the gene encoding human 11beta-hydroxysteroid dehydrogenase type 1 and body mass index, waist to hip ratio, and glucocorticoid metabolism.
12390875 2002 Intracrine induction of 11beta-hydroxysteroid dehydrogenase type 1 expression by glucocorticoid potentiates prostaglandin production in the human chorionic trophoblast.
12202416 2002 Regulation of 11beta-hydroxysteroid dehydrogenase type 1 gene expression in human ovarian surface epithelial cells by interleukin-1.
12109593 2002 11beta-Hydroxysteroid dehydrogenase types 1 and 2 are up- and downregulated in cortisol-secreting adrenal adenomas.
11956655 2002 Human adrenal cortex and aldosterone secreting adenomas express both 11beta-hydroxysteroid dehydrogenase type 1 and type 2 genes.
11755176 2002 Effect of cellular differentiation on 11beta-hydroxysteroid dehydrogenase activity in the intestine.
11114699 2000 Association between a variant in the 11 beta-hydroxysteroid dehydrogenase type 2 gene and primary hypertension.
10962348 2000 Expression and functional consequences of 11beta-hydroxysteroid dehydrogenase activity in human bone.
10645953 2000 A preliminary gene map for the Van der Woude syndrome critical region derived from 900 kb of genomic sequence at 1q32-q41.
10497258 1999 Mutational analysis of Escherichia coli DNA ligase identifies amino acids required for nick-ligation in vitro and for in vivo complementation of the growth of yeast cells deleted for CDC9 and LIG4.
10497248 1999 The N-terminal anchor sequences of 11beta-hydroxysteroid dehydrogenases determine their orientation in the endoplasmic reticulum membrane.
9543163 1998 Immunohistochemical localization of type 1 11beta-hydroxysteroid dehydrogenase in human tissues.
9034789 1997 11 beta-Hydroxysteroid dehydrogenase and the syndrome of apparent mineralocorticoid excess.
7670488 1995 Human hypertension caused by mutations in the kidney isozyme of 11 beta-hydroxysteroid dehydrogenase.
7545619 1995 Detection of human 11 beta-hydroxysteroid dehydrogenase isoforms using reverse-transcriptase-polymerase chain reaction and localization of the type 2 isoform to renal collecting ducts.
1885595 1991 The human gene for 11 beta-hydroxysteroid dehydrogenase. Structure, tissue distribution, and chromosomal localization.