Property Summary

NCBI Gene PubMed Count 17
PubMed Score 47.28
PubTator Score 19.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8IWL3 Q9BWS7
Symbols JAC1
HSC20
DNAJC20

Gene

PDB

3BVO  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT      1 - 70
RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY     71 - 140
LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE    141 - 210
AKEILTKMRYFSNIEEKIKLKKIPL                                                 211 - 235
//

Text Mined References (18)

PMID Year Title