Property Summary

NCBI Gene PubMed Count 17
PubMed Score 47.28
PubTator Score 19.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (6)

AA Sequence

MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT      1 - 70
RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY     71 - 140
LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE    141 - 210
AKEILTKMRYFSNIEEKIKLKKIPL                                                 211 - 235
//

Text Mined References (18)

PMID Year Title