Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.34
PubTator Score 11.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 1.8e-09
acute myeloid leukemia -1.500 2.7e-02
ovarian cancer -1.500 4.4e-06

Synonym

Accession O75506 Q53XA8 Q7Z5Z3
Symbols NPC-A-13

Gene

PDB

3CI9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
24816843 HSBP1 is crucial for regulating resistance to radiotherapy of oral squamous epithelial carcinoma cells by inducing stem-like status.
21247889 HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1
18767159 This study reports the crystal structure of a degradation-resistant fragment of HSBP1. A continuous, long-helix conformation of HSBP1 assembles into a coiled-coil three-helix bundle and subsequently into an elongated, symmetrical hexamer.
11679589 HSBP likely mediates its function through its trimerization domain.

AA Sequence

MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI      1 - 70
PATQKS                                                                     71 - 76
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816843 2014 Overexpression of HSBP1 is associated with resistance to radiotherapy in oral squamous epithelial carcinoma.
21247889 2011 The heat shock-binding protein (HspBP1) protects cells against the cytotoxic action of the Tag7-Hsp70 complex.
18767159 2009 Crystal structure of the hexamer of human heat shock factor binding protein 1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11679589 2002 Structure-function analysis of the heat shock factor-binding protein reveals a protein composed solely of a highly conserved and dynamic coiled-coil trimerization domain.
9649501 1998 Negative regulation of the heat shock transcriptional response by HSBP1.
9493008 1997 The heat-shock response: regulation and function of heat-shock proteins and molecular chaperones.