Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.19
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Pneumoconiosis 15 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.2e-32
nasopharyngeal carcinoma 1058 9.8e-09
Atopic dermatitis 952 8.2e-05
interstitial cystitis 2312 2.5e-03
spina bifida 1074 1.7e-02
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 3 14 4.054 2.0
Microcephaly 166 3.223 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.600 8.2e-05
interstitial cystitis -2.000 2.5e-03
nasopharyngeal carcinoma -1.600 9.8e-09
psoriasis -2.100 1.2e-32
spina bifida -1.508 1.7e-02

Gene RIF (1)

AA Sequence

MAGSGGLGGGAGGGQGAGAGQGAALRASRAPMLLVALVLGAYCLCALPGRCPPAARAPAPAPAPSEPSSS      1 - 70
VHRPGAPGLPLASGPGRRRFPQALIVGVKKGGTRALLEFLRLHPDVRALGSEPHFFDRCYERGLAWYRSL     71 - 140
MPRTLDGQITMEKTPSYFVTREAPRRIHAMSPDTKLIVVVRNPVTRAISDYAQTLSKTPGLPSFRALAFR    141 - 210
HGLGPVDTAWSAVRIGLYAQHLDHWLRYFPLSHFLFVSGERLVSDPAGEVGRVQDFLGLKRVVTDKHFYF    211 - 280
NATKGFPCLKKAQGGSRPRCLGKSKGRPHPRVPQALVRRLQEFYRPFNRRFYQMTGQDFGWG            281 - 342
//

Text Mined References (6)

PMID Year Title