Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.02
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
psoriasis 6685 6.4e-24
ependymoma 2514 9.1e-09
interstitial cystitis 2299 4.3e-06
urothelial carcinoma 318 5.0e-05
group 4 medulloblastoma 1875 1.3e-03
Disease Target Count Z-score Confidence
Herpes simplex 19 3.026 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
urothelial carcinoma -1.800 5.0e-05
ependymoma -1.100 9.1e-09
interstitial cystitis -1.700 4.3e-06
group 4 medulloblastoma -1.100 1.3e-03
psoriasis -2.600 6.4e-24

Gene RIF (4)

PMID Text
18978678 Observational study of gene-disease association. (HuGE Navigator)
16099108 Structural analysis of 3-OST-5 HS(act) revealed that the antithrombin-binding site of 3-OST-5 HS(act) is located within a domain clustered with N-sulfated glucosamine units.
15026143 Results demonstrate that the human 3-O-sulfotransferase isoform 5 gene is capable of synthesizing anticoagulant heparan sulfate (HS) in CHO cells and may contribute to the biosynthesis of HS in humans.
12740361 Recombinant 3-OST-5 only exhibited sulfotransferase activity toward heparan sulfate and heparin. 3-OST-5 was highly expressed in fetal brain, followed by adult brain and spinal cord, and at very low or undetectable levels in other tissues.

AA Sequence

MLFKQQAWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHE      1 - 70
FRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYGKGIEWYR     71 - 140
KKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKF    141 - 210
EKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRIS    211 - 280
QYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP        281 - 346
//

Text Mined References (11)

PMID Year Title
24086445 2013 Genome-wide association analysis with gray matter volume as a quantitative phenotype in first-episode treatment-naïve patients with schizophrenia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18223645 2008 Engineering sulfotransferases to modify heparan sulfate.
16099108 2005 Characterization of the structure of antithrombin-binding heparan sulfate generated by heparan sulfate 3-O-sulfotransferase 5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15026143 2004 The biosynthesis of anticoagulant heparan sulfate by the heparan sulfate 3-O-sulfotransferase isoform 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12740361 2003 Characterization of a heparan sulfate 3-O-sulfotransferase-5, an enzyme synthesizing a tetrasulfated disaccharide.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138164 2002 Heparan sulfate 3-O-sulfotransferase isoform 5 generates both an antithrombin-binding site and an entry receptor for herpes simplex virus, type 1.