Tbio | Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 |
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Catalyzes the O-sulfation of glucosamine in IdoUA2S-GlcNS and also in IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta. [provided by RefSeq, Dec 2014]
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta. [provided by RefSeq, Dec 2014]
Comments
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6694 | 4.0e-79 |
non-small cell lung cancer | 2890 | 6.2e-11 |
cystic fibrosis | 1696 | 1.5e-07 |
malignant mesothelioma | 3232 | 6.4e-07 |
pancreatic cancer | 2398 | 1.0e-04 |
Atopic dermatitis | 952 | 4.8e-04 |
subependymal giant cell astrocytoma | 2287 | 1.9e-03 |
adrenocortical carcinoma | 1428 | 4.1e-03 |
ependymoma | 4679 | 4.3e-03 |
cutaneous lupus erythematosus | 1057 | 4.7e-03 |
osteosarcoma | 7950 | 9.4e-03 |
pediatric high grade glioma | 1064 | 1.2e-02 |
aldosterone-producing adenoma | 665 | 1.2e-02 |
glioblastoma | 5792 | 2.4e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Vascular disease | 319 | 0.0 | 1.1 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Hereditary spherocytosis type 3 | 14 | 3.711 | 1.9 |
Disease | log2 FC | p |
---|---|---|
adrenocortical carcinoma | -1.278 | 4.1e-03 |
aldosterone-producing adenoma | -1.804 | 1.2e-02 |
Atopic dermatitis | 1.700 | 4.8e-04 |
cutaneous lupus erythematosus | 1.600 | 4.7e-03 |
cystic fibrosis | 4.457 | 1.5e-07 |
ependymoma | 1.600 | 4.3e-03 |
glioblastoma | 2.100 | 2.4e-02 |
malignant mesothelioma | -1.700 | 6.4e-07 |
non-small cell lung cancer | 1.194 | 6.2e-11 |
osteosarcoma | 2.664 | 9.4e-03 |
pancreatic cancer | 1.200 | 1.0e-04 |
pediatric high grade glioma | 1.900 | 1.2e-02 |
psoriasis | 2.600 | 4.0e-79 |
subependymal giant cell astrocytoma | 4.004 | 1.9e-03 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG |
MAPPGPASALSTSAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCQTLSGPVVGLSGGGEEAGAPGGGV 1 - 70 LAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT 71 - 140 LALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQ 141 - 210 ITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLID 211 - 280 TSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFP 281 - 350 CLKKAEGSSRPHCLGKTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWDG 351 - 406 //