Property Summary

NCBI Gene PubMed Count 33
PubMed Score 189.84
PubTator Score 76.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 2.5e-03
Astrocytoma, Pilocytic -1.100 2.0e-03
ependymoma -1.100 1.0e-02
facioscapulohumeral dystrophy -1.300 1.9e-02
group 3 medulloblastoma 1.500 1.8e-02
osteosarcoma -1.126 1.4e-03
Pick disease 1.200 5.3e-04
pituitary cancer -1.300 7.0e-04

Gene RIF (18)

AA Sequence

MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP      1 - 70
WLCAAAQVAALAAWLLGRRNL                                                      71 - 91
//

Text Mined References (34)

PMID Year Title