Property Summary

Ligand Count 577
NCBI Gene PubMed Count 97
PubMed Score 1031.12
PubTator Score 148.74

Knowledge Summary

Patent (9,225)

TINX Plot

  Disease (6)

Disease Target Count
Allergic rhinitis (disorder) 5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.800 4.9e-03
Astrocytoma, Pilocytic 1.600 1.5e-04
chronic kidney disease 1.200 1.8e-02
ependymoma -1.200 2.1e-02
glioblastoma 1.300 3.0e-03
intraductal papillary-mucinous carcinoma... 1.400 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.000 2.1e-03
invasive ductal carcinoma -1.500 6.8e-03
lung cancer -1.300 2.0e-02
medulloblastoma -1.100 2.2e-03
osteosarcoma 2.259 4.1e-05
ovarian cancer 1.200 6.8e-03
pancreatic cancer 1.100 3.0e-04
tuberculosis -1.200 2.2e-06

Gene RIF (75)

AA Sequence

MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLS      1 - 70
VADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRT     71 - 140
KTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFY    141 - 210
AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP    211 - 280
KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ    281 - 350
MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI    351 - 420
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS       421 - 487
//

Text Mined References (104)

PMID Year Title