Property Summary

NCBI Gene PubMed Count 74
PubMed Score 285.19
PubTator Score 175.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.0e-03
ovarian cancer 1.100 2.6e-09
psoriasis -1.200 1.4e-07

Gene RIF (34)

PMID Text
26354857 HRG attenuates DNA- and RNA-mediated FXII activation, and FXI activation by FXIIa or by thrombin, suggesting that HRG down regulates the capacity of DNA and RNA to activate the intrinsic coagulation pathway.
26336134 HRG could inhibit hepatocellular carcinoma cell proliferation via the FGF-Erk1/2 signaling pathway by reducing Erk1/2 phosphorylation.
26051322 HRG binds to alpha2 integrin through low-affinity interactions in a heparin sulfate-independent manner, thereby blocking endothelial cells adhesion to collagen I.
25363753 Results show that HRG is a novel transcriptional target gene of FXR in human hepatoma cells, human upcyteVR primary hepatocytes and 3D human liver microtissues in vitro and in mouse liver in vivo.
25353308 Plasma free fatty acid levels influence Zn(2+) -dependent histidine-rich glycoprotein-heparin interactions via an allosteric switch on serum albumin.
25243896 mononuclear phagocytes have specific binding sites for HRG and that these cells are essential for uptake of HRG from blood and distribution of HRG in tissues. Thus, inflammatory cells mediate the effect of HRG on tumor growth and metastatic spread.
25064236 genetic association study in Swedish population: Data suggest SNP in HRG (rs2228243, A1042G) is associated with recurrent miscarriage in population studied; women heterozygous for HRG A1042G SNP are protected from recurrent miscarriage. [PILOT STUDY]
24567057 histidine-rich glycoprotein tissue RNA and serum protein might have a role in breast cancer
23672470 Association between the histidine-rich glycoprotein (HRG) C633T single nucleotide polymorphism (SNP) and recurrent miscarriage was investigated. An association between homozygous carriers and recurrent miscarriage was detected.
23576524 HRG does not exhibit the broad interactive properties that have been reported previously, suggesting that copurification of HRG-binding partners or other impurities are responsible for some of the reported functional properties.
22895448 The combination of lowered HRG and uterine artery Doppler may predict preterm preeclampsia in early pregnancy.
21757718 the HRG-fibrin interaction may provide a novel link between coagulation, innate immunity, and inflammation
21665544 the genetic polymorphism (rs9898 C/T) in the HRG gene of a woman affects her chances of becoming pregnant after IVF
21304106 by binding to factor XIIa, HRG modulates the intrinsic pathway of coagulation, particularly in the vicinity of a thrombus where platelet release of HRG and Zn(2)(+) will promote this interaction
21215706 Host-produced HRG inhibits tumor growth and metastasis by skewing tumor-associated macrophages (TAM) polarization away from the M2- to a tumor-inhibiting M1-like phenotype. Skewing of TAM polarization by HRG relies substantially on downregulation of PlGF.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20573803 HRG can aid the phagocytosis of necrotic cells via a heparan sulfate-dependent pathway, and this process can be regulated by the presence of certain HRG ligands, such as heparin.
20303064 Single Nucleotide Polymorphisms in HRG is associated with activated partial thromboplastin time.
20303064 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20071662 HRG has the unique property of complexing with IgG and facilitating a proinflammatory innate immune response to promote the clearance of necrotic cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19712047 Proteolytic cleavage of HRG by plasmin may provide a feedback mechanism to regulate the effects of HRG on the plasminogen/plasmin system and other functions of HRG.
19674792 HRG may assist in the maintenance of normal immune function by mediating the clearance of necrotic material, inhibiting the formation of insoluble immune complexes and enhancing their ability to activate complement, resulting in faster clearance.
19285951 identified the alpha-subunit of ATP synthase as one of the HRG-binding proteins on the surface of T-cells by HRG-derived glycopeptide affinity chromatography and by a peptide mass finger printing method
18797515 The protein encoded by this gene has a peptide that displays antimicrobial activity against C. albicans, E. coli, S. aureus, P. aeruginosa, and E. faecalis.
17229145 the histidine-rich and heparin-binding domain of HRGP mediates the antibacterial activity of the protein
16436387 the anti-angiogenic His/Pro-rich fragment of histidine-rich glycoprotein binds to endothelial cell heparan sulfate in a Zn2+-dependent manner
16107330 HRG has the unique property of selectively recognizing necrotic cells and may play an important physiological role in vivo by facilitating the uptake and clearance of necrotic, but not apoptotic, cells by phagocytes
15269838 HPRG binds to endothelial cell surface tropomyosin which at least partially mediates the antiangiogenic effects of HPRG
15220341 HRG acts as a soluble adaptor molecule that binds to cells at sites of tissue injury, tumor growth, and angiogenesis
15138272 Histidine-rich glycoprotein binds to cell-surface heparan sulfate via its N-terminal domain following Zn2+ chelation
12764609 Data indicate that histidine-rich glycoprotein, in combination with the zinc ion, modulates the smooth muscle cell growth response in pathophysiological states.
12391183 By acting as a bridge between DNA on apoptotic cells and Fc gamma RI on monocyte-derived macrophages, HRG is a key physiological mediator of apoptotic cell clearance by macrophages.

AA Sequence

MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDRVENTTVYYLV      1 - 70
LDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLRVIDFNCTTSSVSSALANTKD     71 - 140
SPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGGEGTGYFVDFSVRNCPRHHFPR    141 - 210
HPNVFGFCRADLFYDVEALDLESPKNLVINCEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKP    211 - 280
HGSRDHHHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLH    281 - 350
PHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP    351 - 420
PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSFPLPHHKHPLK    421 - 490
PDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK                                       491 - 525
//

Text Mined References (81)

PMID Year Title
26354857 2016 Histidine-rich glycoprotein binds DNA and RNA and attenuates their capacity to activate the intrinsic coagulation pathway.
26336134 2015 Histidine-rich glycoprotein function in hepatocellular carcinoma depends on its N-glycosylation status, and it regulates cell proliferation by inhibiting Erk1/2 phosphorylation.
26051322 2015 Histidine-rich glycoprotein blocks collagen-binding integrins and adhesion of endothelial cells through low-affinity interaction with ?2 integrin.
25363753 2015 The nuclear bile acid receptor FXR controls the liver derived tumor suppressor histidine-rich glycoprotein.
25353308 2015 Plasma free fatty acid levels influence Zn(2+) -dependent histidine-rich glycoprotein-heparin interactions via an allosteric switch on serum albumin.
25243896 2014 Histidine-rich glycoprotein uptake and turnover is mediated by mononuclear phagocytes.
25064236 2014 The histidine-rich glycoprotein A1042G polymorphism and recurrent miscarriage: a pilot study.
24825900 2014 Functional and structural properties of a novel protein and virulence factor (Protein sHIP) in Streptococcus pyogenes.
24567057 2014 Evaluation of histidine-rich glycoprotein tissue RNA and serum protein as novel markers for breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23672470 2013 Histidine-rich glycoprotein gene polymorphism in patients with recurrent miscarriage.
23576524 2013 New method for purifying histidine-rich glycoprotein from human plasma redefines its functional properties.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22895448 2012 Prediction of preeclampsia by combining serum histidine-rich glycoprotein and uterine artery Doppler.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21757718 2011 Histidine-rich glycoprotein binds fibrin(ogen) with high affinity and competes with thrombin for binding to the gamma'-chain.
21665544 2011 Histidine-rich glycoprotein polymorphism and pregnancy outcome: a pilot study.
21304106 2011 Histidine-rich glycoprotein binds factor XIIa with high affinity and inhibits contact-initiated coagulation.
21215706 2011 HRG inhibits tumor growth and metastasis by inducing macrophage polarization and vessel normalization through downregulation of PlGF.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20573803 2010 Histidine-rich glycoprotein functions cooperatively with cell surface heparan sulfate on phagocytes to promote necrotic cell uptake.
20561914 2010 Histidine-rich glycoprotein binds heparanase and regulates its enzymatic activity and cell surface interactions.
20303064 2010 Common variants of large effect in F12, KNG1, and HRG are associated with activated partial thromboplastin time.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20071662 2010 Histidine-rich glycoprotein is a novel plasma pattern recognition molecule that recruits IgG to facilitate necrotic cell clearance via FcgammaRI on phagocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903770 2009 Activated platelets provide a functional microenvironment for the antiangiogenic fragment of histidine-rich glycoprotein.
19786305 2009 Probing the Cu(2+) and Zn(2+) binding affinity of histidine-rich glycoprotein.
19712047 2009 Regulation of histidine-rich glycoprotein (HRG) function via plasmin-mediated proteolytic cleavage.
19674792 2009 Interactions of histidine-rich glycoprotein with immunoglobulins and proteins of the complement system.
19535045 2009 Histidine-rich glycoprotein and concanavalin A synergistically stimulate the phosphatidylinositol 3-kinase-independent signaling pathway in leukocytes leading to increased cell adhesion and changes in cell morphology.
19285951 2009 High affinity interaction between histidine-rich glycoprotein and the cell surface type ATP synthase on T-cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18797515 2008 Histidine-rich glycoprotein protects from systemic Candida infection.
17229145 2007 Histidine-rich glycoprotein exerts antibacterial activity.
16489009 2006 Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein.
16436387 2006 The anti-angiogenic His/Pro-rich fragment of histidine-rich glycoprotein binds to endothelial cell heparan sulfate in a Zn2+-dependent manner.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16107330 2005 Histidine-rich glycoprotein specifically binds to necrotic cells via its amino-terminal domain and facilitates necrotic cell phagocytosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313924 2004 Peptides derived from the histidine-proline domain of the histidine-proline-rich glycoprotein bind to tropomyosin and have antiangiogenic and antitumor activities.
15269838 2004 Histidine-proline rich glycoprotein (HPRG) binds and transduces anti-angiogenic signals through cell surface tropomyosin on endothelial cells.
15220341 2004 Plasminogen is tethered with high affinity to the cell surface by the plasma protein, histidine-rich glycoprotein.
15138272 2004 Histidine-rich glycoprotein binds to cell-surface heparan sulfate via its N-terminal domain following Zn2+ chelation.
14744774 2004 A fragment of histidine-rich glycoprotein is a potent inhibitor of tumor vascularization.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12764609 2003 Histidine-rich glycoprotein plus zinc reverses growth inhibition of vascular smooth muscle cells by heparin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391183 2002 Histidine-rich glycoprotein binds to DNA and Fc gamma RI and potentiates the ingestion of apoptotic cells by macrophages.
12235005 2002 Histidine-proline-rich glycoprotein has potent antiangiogenic activity mediated through the histidine-proline-rich domain.
11134179 2001 Histidine-rich glycoprotein inhibits the antiangiogenic effect of thrombospondin-1.
11057869 2000 Histidine-rich glycoprotein (HRG) Tokushima 2: novel HRG deficiency, molecular and cellular characterization.
10514432 1999 Differential binding of histidine-rich glycoprotein (HRG) to human IgG subclasses and IgG molecules containing kappa and lambda light chains.
10421785 1999 Histidine-rich glycoprotein regulates the binding of monomeric IgG and immune complexes to monocytes.
10050040 1999 Structural characterization of the gene for human histidine-rich glycoprotein, reinvestigation of the 5'-terminal region of cDNA and a search for the liver specific promoter in the gene.
9414276 1998 HRG Tokushima: molecular and cellular characterization of histidine-rich glycoprotein (HRG) deficiency.
9276466 1997 Human histidine-rich glycoprotein expressed in SF9 insect cells inhibits apatite formation.
9184145 1997 Histidine-rich glycoprotein binds to human IgG and C1q and inhibits the formation of insoluble immune complexes.
8478593 1993 Familial association of high levels of histidine-rich glycoprotein and plasminogen activator inhibitor-1 with venous thromboembolism.
8478589 1993 Histidine-rich glycoprotein: an abundant plasma protein in search of a function.
8348977 1993 Determination of the disulphide bridge arrangement of bovine histidine-rich glycoprotein.
8188234 1994 Evidence for the absence of intron H of the histidine-rich glycoprotein (HRG) gene: genetic mapping and in situ localization of HRG to chromosome 3q28-q29.
6740558 1984 Histidine-rich glycoprotein modulates the anticoagulant activity of heparin in human plasma.
6438154 1984 Complex formation of platelet thrombospondin with plasminogen. Modulation of activation by tissue activator.
6414553 1983 Histidine-rich glycoprotein is present in human platelets and is released following thrombin stimulation.
4116337 1972 [Human serum proteins with high affinity to carboxymethylcellulose. II. Physico-chemical and immunological characterization of a histidine-rich 3,8S- 2 -glycoportein (CM-protein I)].
3958188 1986 Interaction of histidine-rich glycoprotein with fibrinogen and fibrin.
3819648 1987 Histidine-rich glycoprotein inhibits the antiproliferative effect of heparin on smooth muscle cells.
3011081 1986 Amino acid sequence of human histidine-rich glycoprotein derived from the nucleotide sequence of its cDNA.
2566603 1989 Interaction of histidine-rich glycoprotein with human T lymphocytes.
2524479 1989 Histidine-rich glycoprotein blocks T cell rosette formation and modulates both T cell activation and immunoregulation.
2347592 1990 Assignment of the human gene for histidine-rich glycoprotein to chromosome 3.
1678514 1991 KpnI RFLP in the human histidine-rich glycoprotein gene.
1561009 1992 Identification of histidine-rich glycoprotein in human colostrum and milk.
1459097 Plasma protein map: an update by microsequencing.
678554 1978 Human serum histidine-rich glycoprotein. I. Interactions with heme, metal ions and organic ligands.