Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.53
PubTator Score 568.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy -1.349 1.7e-04
adrenocortical carcinoma 1.041 2.0e-02
Astrocytoma, Pilocytic 1.200 2.0e-02
autosomal dominant Emery-Dreifuss muscul... -1.115 8.2e-03
Breast cancer 2.000 7.6e-05
colon cancer 1.300 5.0e-02
cutaneous lupus erythematosus -2.200 1.3e-02
dermatomyositis 1.300 1.5e-03
ependymoma -1.400 4.6e-02
esophageal adenocarcinoma -1.200 2.2e-02
gastric cancer 1.500 2.1e-03
intraductal papillary-mucinous carcinoma... 2.300 1.5e-02
lung carcinoma 1.800 5.6e-26
malignant mesothelioma 1.900 8.6e-06
non primary Sjogren syndrome sicca 1.200 5.0e-03
non-small cell lung cancer 2.217 6.5e-13
oligodendroglioma -1.800 3.5e-02
ovarian cancer -1.300 1.3e-02
pancreatic cancer 2.100 1.0e-03
pancreatic carcinoma 2.100 1.0e-03
psoriasis 1.400 1.2e-02

Synonym

Accession Q9HDD0 D2KX19
Symbols A-C1
HRSL1
HSD28
HRASLS1
H-REV107

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQL      1 - 70
LKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAI     71 - 140
STVEFVTAAVGVFSFLGLFPKGQRAKYY                                              141 - 168
//

Text Mined References (8)

PMID Year Title