Property Summary

NCBI Gene PubMed Count 33
PubMed Score 399.92
PubTator Score 294.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 9.3e-07
group 3 medulloblastoma -1.400 1.6e-03
lung carcinoma -1.100 5.6e-09
medulloblastoma, large-cell -1.300 3.4e-03
mucosa-associated lymphoid tissue lympho... 1.196 4.8e-02
osteosarcoma -1.223 1.1e-05
primitive neuroectodermal tumor -1.100 1.6e-03

Gene RIF (12)

AA Sequence

MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN      1 - 70
DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL     71 - 140
TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP    141 - 210
SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT    211 - 280
FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN      281 - 348
//

Text Mined References (34)

PMID Year Title