Property Summary

NCBI Gene PubMed Count 56
PubMed Score 312.31
PubTator Score 87.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.205 1.1e-02
pancreatic ductal adenocarcinoma liver m... -2.222 2.7e-02
intraductal papillary-mucinous neoplasm ... -2.200 1.1e-02
active Crohn's disease 1.003 1.8e-02
breast carcinoma 1.400 8.5e-04
fibroadenoma 1.200 1.8e-02
Breast cancer 1.200 2.0e-04
invasive ductal carcinoma 1.300 1.6e-02
ovarian cancer -1.300 6.3e-06
pancreatic cancer -2.300 7.9e-04
psoriasis -1.400 5.1e-16

Gene RIF (25)

PMID Text
26673890 These data demonstrate that the membrane-bound serine protease hepsin is the enzyme responsible for the physiological cleavage of uromodulin.
26165838 The findings suggest that the oncogenic activity of hepsin arises not only from elevated expression level but also from depletion of HAI-1, events which together trigger gain-of-function activity impacting HGF/MET signalling and epithelial cohesion
26139199 The Hepsin pathway acts in concert with Wnt pathway to promote prostate cancer progression.
26014348 Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival
25576733 Hepsin suppressed CDK11p58 internal ribosome entry site activity in prostate cancer cells by modulating UNR expression and eIF-2alpha phosphorylation.
22665141 The results of this study suggest that, in Korean men, some polymorphisms in the HPN gene might be associated with the risk of developing prostate cancer.
21875933 These findings suggest that the MSP/RON signaling pathway may be regulated by hepsin in tissue homeostasis and in disease pathologies, such as in cancer and immune disorders.
21750652 Elevated levels of hepsin interfere with cell adhesion and viability in the background of prostate cancer as well as other tissue types, the details of which depend on the microenvironment provided.
21383634 hepsin expression is frequently up-regulated in breast cancer tissues, which is associated with tumor growth and progression
20673210 Hepsin activity was inhibited by anthralin and increased by resveratrol.
20166135 Germline genetic variation of HPN does not seem to contribute to risk of prostate cancer or prognosis.
20166135 Observational study of gene-disease association. (HuGE Navigator)
20015050 HGF is activated by the transmembrane serine proteases matriptase and hepsin, but not by the membrane-associated protease uPA.
19911255 Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor.
18784072 Ln-332 may be one mechanism by which hepsin promotes prostate tumor progression and metastasis, possibly by up-regulating prostate cancer cell motility.
18698500 Hepsin showed potential inhibitory effects mediated by the induction of 14-3-3sigma expression which leads to both cell cycle arrest at the G2/M phase
18487557 We analyzed all the common variations using tag SNP in the HPN and LTBP4 genes for association with IA in 390 patients and 642 controls in the Dutch population.
18487557 Observational study of gene-disease association. (HuGE Navigator)
17309599 Our findings suggest that the balance between hepsin and its inhibitor, HAI-2, may have prognostic value in RCC.
16908524 the ability of hepsin to efficiently activate pro-uPA suggests that it may initiate plasmin-mediated proteolytic pathways at the tumor/stroma interface that lead to basement membrane disruption and tumor progression
16783571 Observational study of gene-disease association. (HuGE Navigator)
16783571 A major 11-locus haplotype is significantly associated with prostate cancer, which provides further support that HPN is a potentially important candidate gene involved in prostate cancer susceptibility.
15792801 Hepsin is functionally linked to hepatocyte growth factor/MET pathway, which may contribute to prostate cancer progression.
15583422 Observational study of gene-disease association. (HuGE Navigator)
12629351 Hepsin and maspin are inversely expressed in laser capture microdissectioned prostate cancer

AA Sequence

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTE      1 - 70
GTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDC     71 - 140
PRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNR    141 - 210
VLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA    211 - 280
AGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQ    281 - 350
GDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL       351 - 417
//

Text Mined References (58)

PMID Year Title
26673890 2015 The serine protease hepsin mediates urinary secretion and polymerisation of Zona Pellucida domain protein uromodulin.
26165838 2016 Deregulated hepsin protease activity confers oncogenicity by concomitantly augmenting HGF/MET signalling and disrupting epithelial cohesion.
26139199 2015 Concurrent Hepsin overexpression and adenomatous polyposis coli deletion causes invasive prostate carcinoma in mice.
26014348 2015 Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival.
25576733 2015 Hepsin inhibits CDK11p58 IRES activity by suppressing unr expression and eIF-2? phosphorylation in prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227843 2014 TMPRSS2 and ADAM17 cleave ACE2 differentially and only proteolysis by TMPRSS2 augments entry driven by the severe acute respiratory syndrome coronavirus spike protein.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22665141 2012 Variants in the HEPSIN gene are associated with susceptibility to prostate cancer.
22132769 2012 Allosteric antibody inhibition of human hepsin protease.
21875933 2011 Proteolytic activation of pro-macrophage-stimulating protein by hepsin.
21750652 2011 Matrix-dependent regulation of AKT in Hepsin-overexpressing PC3 prostate cancer cells.
21383634 2011 Clinical and biological significance of hepsin overexpression in breast cancer.
20673210 2010 Isolation, purification, and study of properties of recombinant hepsin from Escherichia coli.
20166135 2010 Association of hepsin gene variants with prostate cancer risk and prognosis.
20015050 2010 Pericellular activation of hepatocyte growth factor by the transmembrane serine proteases matriptase and hepsin, but not by the membrane-associated protease uPA.
19911255 2010 Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor.
19843851 2009 Pegylated kunitz domain inhibitor suppresses hepsin-mediated invasive tumor growth and metastasis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18852137 2008 Identification and characterization of small-molecule inhibitors of hepsin.
18784072 2008 Laminin-332 is a substrate for hepsin, a protease associated with prostate cancer progression.
18698500 2008 Hepsin inhibits the cell growth of endometrial cancer.
18487557 2008 Genes involved in the transforming growth factor beta signalling pathway and the risk of intracranial aneurysms.
18383840 Expression of the serine protease hepsin and clinical outcome of human endometrial cancer.
18381435 2008 Detection of early prostate cancer using a hepsin-targeted imaging agent.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17918732 2008 An integrated genetic and functional analysis of the role of type II transmembrane serine proteases (TMPRSSs) in hearing loss.
17569629 2007 Hepsin and prostate cancer.
17309599 2007 Clinical relevance of hepsin and hepatocyte growth factor activator inhibitor type 2 expression in renal cell carcinoma.
16911458 2006 Decreased expressions of hepsin in human hepatocellular carcinomas.
16908524 2006 Pro-urokinase-type plasminogen activator is a substrate for hepsin.
16783571 2006 Variants in the HEPSIN gene are associated with prostate cancer in men of European origin.
16585186 2006 Antibodies neutralizing hepsin protease activity do not impact cell growth but inhibit invasion of prostate and ovarian tumor cells in culture.
16391794 2006 Hepsin shows inhibitory effects through apoptotic pathway on ovarian cancer cell lines.
15839837 2005 Hepatocyte growth factor is a preferred in vitro substrate for human hepsin, a membrane-anchored serine protease implicated in prostate and ovarian cancers.
15792801 2005 Hepsin activates pro-hepatocyte growth factor and is inhibited by hepatocyte growth factor activator inhibitor-1B (HAI-1B) and HAI-2.
15627507 2005 Identification and characterization of hepsin/-TM, a non-transmembrane hepsin isoform.
15614436 2005 Human hepatitis B virus X protein promotes cell proliferation and inhibits cell apoptosis through interacting with a serine protease Hepsin.
15583422 2004 Analysis of candidate genes for prostate cancer.
15538223 2004 The membrane proteases adams and hepsin are differentially expressed in renal cell carcinoma. Are they potential tumor markers?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324701 2004 Hepsin promotes prostate cancer progression and metastasis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14665873 2004 Hepsin is highly over expressed in and a new candidate for a prognostic indicator in prostate cancer.
12962630 2003 The structure of the extracellular region of human hepsin reveals a serine protease domain and a novel scavenger receptor cysteine-rich (SRCR) domain.
12629351 2003 Hepsin and maspin are inversely expressed in laser capture microdissectioned prostate cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12460890 2002 HEPSIN inhibits cell growth/invasion in prostate cancer cells.
11479199 2001 Expression profiling reveals hepsin overexpression in prostate cancer.
11171558 2001 Gene targeting in hemostasis. Hepsin.
9569208 1998 Expression of the factor VII activating protease, hepsin, in situ in renal cell carcinoma.
9230195 1997 Hepsin, a cell surface serine protease identified in hepatoma cells, is overexpressed in ovarian cancer.
8346233 1993 Hepsin, a putative cell-surface serine protease, is required for mammalian cell growth.
7814421 1995 Hepsin, a putative membrane-associated serine protease, activates human factor VII and initiates a pathway of blood coagulation on the cell surface leading to thrombin formation.
2835076 1988 A novel trypsin-like serine protease (hepsin) with a putative transmembrane domain expressed by human liver and hepatoma cells.
1885621 1991 Hepsin, a cell membrane-associated protease. Characterization, tissue distribution, and gene localization.