Property Summary

Ligand Count 31
NCBI Gene PubMed Count 56
PubMed Score 315.98
PubTator Score 87.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.003 1.8e-02
Breast cancer 1.200 2.0e-04
breast carcinoma 1.400 8.5e-04
fibroadenoma 1.200 1.8e-02
intraductal papillary-mucinous neoplasm ... -2.200 1.1e-02
invasive ductal carcinoma 1.300 1.6e-02
nephrosclerosis -1.205 1.1e-02
ovarian cancer -1.300 6.3e-06
pancreatic cancer -2.300 7.9e-04
pancreatic ductal adenocarcinoma liver m... -2.222 2.7e-02
psoriasis -1.400 5.1e-16

Gene RIF (25)

AA Sequence

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTE      1 - 70
GTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDC     71 - 140
PRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNR    141 - 210
VLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA    211 - 280
AGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQ    281 - 350
GDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL       351 - 417
//

Text Mined References (58)

PMID Year Title