Property Summary

NCBI Gene PubMed Count 30
PubMed Score 4165.29
PubTator Score 108.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
oligodendroglioma -1.200 1.5e-02
uncontrolled asthma 1.300 2.5e-03
psoriasis -1.400 6.0e-07
osteosarcoma -1.413 3.3e-02
glioblastoma 2.200 3.0e-02
Atopic dermatitis -1.600 1.1e-05
non-small cell lung cancer -2.628 2.0e-26
intraductal papillary-mucinous adenoma (... -1.100 1.6e-02
intraductal papillary-mucinous carcinoma... -1.800 3.2e-04
intraductal papillary-mucinous neoplasm ... -1.500 7.5e-03
lung cancer -3.800 1.2e-06
colon cancer -1.300 3.6e-02
active Crohn's disease -1.757 3.4e-02
lung adenocarcinoma -1.400 1.2e-07
pediatric high grade glioma 1.200 1.3e-03
group 3 medulloblastoma -1.200 3.8e-03
pilocytic astrocytoma 1.600 7.7e-08
subependymal giant cell astrocytoma 2.648 7.4e-03
invasive ductal carcinoma 1.417 2.1e-03
lung carcinoma -2.400 2.3e-17
ductal carcinoma in situ -1.300 3.4e-03

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (16)

PMID Text
24996417 The effect of C. molle alkaloid extract on H-PGDS was studied. The alkaloid extract exhibited a 70% inhibition on H-PGDS with an IC50 of 13.7 mug/ml.
22049022 COX-1 and H-PGDS were rapidly ubiquitinated and degraded through the ubiquitin-proteasome system in response to the elevation of the intracellular calcium level
21821144 the Val187Ile HPGDS isoenzyme common among African Americans is not associated with colorectal cancer risk
21683347 In patients with mixed atrophy, testicular mast cell numbers and phenotypes change with respect to the ability to express COX2 and PGDS-H.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20074808 Results describe the activation by Mg++ of human hematopoietic prostaglandin D(2) synthase, using Raman spectroscopy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19276290 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19181746 PU.1 cooperates with MAPK-activated cJun to maximally induce L-PGDS expression in macrophages.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18946232 single nucleotide polymorphism association with asthma in children in Japan
15113825 X-ray structure of human H-PGDS complexed with an inhibitor, 2-(2'-benzothiazolyl)-5-styryl-3-(4'-phthalhydrazidyl) tetrazolium chloride (BSPT) at 1.9 A resolution in the presence of Mg(2+).
12707014 Data suggest that the suppressive effect of hematopoietic prostaglandin D synthase on lung injury could be partly mediated by edema formation and inhibition of genes involved in fibrosis.
12627223 crystal structure when bound to glutathione and Ca+ or Mg+, and enzyme activation
12002745 New polymorphisms of haematopoietic prostaglandin D synthase

AA Sequence

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARY      1 - 70
LTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREW     71 - 140
LIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL               141 - 199
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24996417 2014 Inhibition of hematopoietic prostaglandin D2 synthase (H-PGDS) by an alkaloid extract from Combretum molle.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
22049022 2012 Rapid degradation of cyclooxygenase-1 and hematopoietic prostaglandin D synthase through ubiquitin-proteasome system in response to intracellular calcium level.
21821144 2012 Hematopoietic prostaglandin D synthase (HPGDS): a high stability, Val187Ile isoenzyme common among African Americans and its relationship to risk for colorectal cancer.
21683347 2011 Mast cells in human testicular biopsies from patients with mixed atrophy: increased numbers, heterogeneity, and expression of cyclooxygenase 2 and prostaglandin D2 synthase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20074808 2010 UV resonance Raman studies on the activation mechanism of human hematopoietic prostaglandin D(2) synthase by a divalent cation, Mg(2+).
19939518 2010 Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D2 synthase.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19276290 2009 Common polymorphisms in the prostaglandin pathway genes and their association with breast cancer susceptibility and survival.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19181746 2009 Lipopolysaccharide-dependent interaction between PU.1 and c-Jun determines production of lipocalin-type prostaglandin D synthase and prostaglandin D2 in macrophages.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18946232 2008 Role of prostaglandin D(2) and its receptors in the pathophysiology of asthma.
18341273 2008 Novel prostaglandin D synthase inhibitors generated by fragment-based drug design.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16547010 2006 Structural and functional characterization of HQL-79, an orally selective inhibitor of human hematopoietic prostaglandin D synthase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15113825 2004 First determination of the inhibitor complex structure of human hematopoietic prostaglandin D synthase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12895599 Hematopoietic prostaglandin D synthase.
12707014 2003 Retrovirally introduced prostaglandin D2 synthase suppresses lung injury induced by bleomycin.
12627223 2003 Mechanism of metal activation of human hematopoietic prostaglandin D synthase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12002745 2002 New polymorphisms of haematopoietic prostaglandin D synthase and human prostanoid DP receptor genes.
11672424 2001 Mammalian class Sigma glutathione S-transferases: catalytic properties and tissue-specific expression of human and rat GSH-dependent prostaglandin D2 synthases.
11068878 2000 Interaction of insulin-like growth factor binding protein-4, Miz-1, leptin, lipocalin-type prostaglandin D synthase, and granulin precursor with the N-terminal half of type III hexokinase.
10998423 2000 Transcriptional activation of the human hematopoietic prostaglandin D synthase gene in megakaryoblastic cells. Roles of the oct-1 element in the 5'-flanking region and the AP-2 element in the untranslated exon 1.
10824118 2000 Structure and chromosomal localization of human and mouse genes for hematopoietic prostaglandin D synthase. Conservation of the ancestral genomic structure of sigma-class glutathione S-transferase.
10781097 2000 Prostaglandin D synthase gene is involved in the regulation of non-rapid eye movement sleep.
9475419 1998 Lipocalin-type prostaglandin D synthase in human male reproductive organs and seminal plasma.
9425264 1997 Induction of hematopoietic prostaglandin D synthase in human megakaryocytic cells by phorbol ester.
9353279 1997 Prostaglandin D synthase in human megakaryoblastic cells.