Property Summary

NCBI Gene PubMed Count 107
PubMed Score 191.02
PubTator Score 220.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (30)

Disease log2 FC p
aldosterone-producing adenoma -1.912 3.6e-02
astrocytic glioma -1.100 8.8e-03
Atopic dermatitis -2.000 2.7e-04
chronic rhinosinusitis -1.786 1.1e-02
colon cancer -1.700 1.4e-02
cystic fibrosis -1.100 1.4e-02
glioblastoma -1.100 1.9e-05
head and neck cancer -1.400 5.0e-02
interstitial cystitis -2.100 3.2e-02
intraductal papillary-mucinous adenoma (... 2.300 1.8e-02
intraductal papillary-mucinous carcinoma... 1.100 2.0e-02
intraductal papillary-mucinous neoplasm ... 2.700 6.8e-03
lung adenocarcinoma -2.300 4.7e-09
lung cancer -2.000 6.1e-03
lung carcinoma -5.000 1.4e-31
medulloblastoma -1.100 9.0e-03
non-small cell lung cancer -2.911 1.6e-19
oligodendroglioma -1.200 3.4e-03
osteosarcoma -1.352 2.8e-02
ovarian cancer -1.400 2.1e-03
pancreatic cancer 2.000 7.1e-04
pancreatic ductal adenocarcinoma liver m... -3.270 3.3e-03
pediatric high grade glioma -1.100 6.4e-03
periodontitis -1.100 1.2e-15
primitive neuroectodermal tumor -1.300 1.6e-02
psoriasis -1.400 2.4e-04
Rheumatoid arthritis 1.200 1.2e-02
spina bifida -2.207 4.1e-02
tuberculosis and treatment for 3 months -1.100 1.2e-03
ulcerative colitis -1.700 9.0e-05

Gene RIF (86)

AA Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ      1 - 70
LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA     71 - 140
GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI    141 - 210
KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ                  211 - 266
//

Text Mined References (110)

PMID Year Title